StarFunc result for job id O43298

User Input

>input (467 residues)
MEPGTNSFRVEFPDFSSTILQKLNQQRQQGQLCDVSIVVQGHIFRAHKAVLAASSPYFCD
QVLLKNSRRIVLPDVMNPRVFENILLSSYTGRLVMPAPEIVSYLTAASFLQMWHVVDKCT
EVLEGNPTVLCQKLNHGSDHQSPSSSSYNGLVESFELGSGGHTDFPKAQELRDGENEEES
TKDELSSQLTEHEYLPSNSSTEHDRLSTEMASQDGEEGASDSAEFHYTRPMYSKPSIMAH
KRWIHVKPERLEQACEGMDVHATYDEHQVTESINTVQTEHTVQPSGVEEDFHIGEKKVEA
EFDEQADESNYDEQVDFYGSSMEEFSGERSDGNLIGHRQEAALAAGYSENIEMVTGIKEE
ASHLGFSATDKLYPCQCGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMK
IHTGIKPYECNICAKRFMWRDSFHRHVTSCTKSYEAAKAEQNTTEAN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43298	1.000	1.000	9.748E-70	467	1.000	1.000	O43298.pdb.gz	ZBT43_HUMAN Zinc finger and BTB domain-containing protein 43 OS=Homo sapiens OX=9606 GN=ZBTB43 PE=1 SV=1
2	AFDB:A0A0C4DFQ2	0.263	0.244	7.983E-22	504	0.276	0.256	A0A0C4DFQ2.pdb.gz	A0A0C4DFQ2_HUMAN Zinc finger and BTB domain containing 34 OS=Homo sapiens OX=9606 GN=ZBTB34 PE=1 SV=1
3	AFDB:Q5TC79	0.265	0.247	8.348E-21	503	0.289	0.268	Q5TC79.pdb.gz	ZBT37_HUMAN Zinc finger and BTB domain-containing protein 37 OS=Homo sapiens OX=9606 GN=ZBTB37 PE=2 SV=1
4	AFDB:Q96K62	0.232	0.212	8.730E-20	511	0.212	0.194	Q96K62.pdb.gz	ZBT45_HUMAN Zinc finger and BTB domain-containing protein 45 OS=Homo sapiens OX=9606 GN=ZBTB45 PE=1 SV=1
5	AFDB:Q15916	0.244	0.268	4.175E-19	424	0.266	0.292	Q15916.pdb.gz	ZBTB6_HUMAN Zinc finger and BTB domain-containing protein 6 OS=Homo sapiens OX=9606 GN=ZBTB6 PE=1 SV=1
6	AFDB:Q8NCP5	0.239	0.198	1.215E-17	570	0.218	0.179	Q8NCP5.pdb.gz	ZBT44_HUMAN Zinc finger and BTB domain-containing protein 44 OS=Homo sapiens OX=9606 GN=ZBTB44 PE=1 SV=1
7	AFDB:Q8BID6	0.273	0.215	4.566E-17	600	0.218	0.170	Q8BID6.pdb.gz	ZBT46_MOUSE Zinc finger and BTB domain-containing protein 46 OS=Mus musculus OX=10090 GN=Zbtb46 PE=1 SV=2
8	AFDB:Q13105	0.212	0.129	1.936E-16	803	0.233	0.136	Q13105.pdb.gz	ZBT17_HUMAN Zinc finger and BTB domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ZBTB17 PE=1 SV=3
9	AFDB:Q9H5J0	0.262	0.216	3.085E-15	574	0.208	0.169	Q9H5J0.pdb.gz	ZBTB3_HUMAN Zinc finger and BTB domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ZBTB3 PE=1 SV=1
10	AFDB:Q86T24	0.236	0.166	5.303E-15	672	0.223	0.155	Q86T24.pdb.gz	KAISO_HUMAN Transcriptional regulator Kaiso OS=Homo sapiens OX=9606 GN=ZBTB33 PE=1 SV=2
11	PDB:6wcqC	0.220	0.739	3.738E-8	130	0.073	0.262	6wcqC.pdb.gz
12	PDB:7mk2A	0.223	0.290	1.244E-3	354	0.039	0.051	7mk2A.pdb.gz	Structural basis of NPR1 in activating plant immunity.
13	PDB:5vztA	0.178	0.526	4.403E-3	145	0.034	0.110	5vztA.pdb.gz	Structural basis of the phosphorylation-independent recognition of cyclin D1 by the SCFFBXO31 ubiquitin ligase.
14	PDB:2p1nD	0.166	0.528	5.948E-3	127	0.032	0.118	2p1nD.pdb.gz	Mechanism of auxin perception by the TIR1 ubiquitin ligase
15	PDB:7w6sB	0.177	0.184	8.536E-3	448	0.043	0.045	7w6sB.pdb.gz
16	PDB:3ogkA	0.182	0.527	9.065E-3	145	0.036	0.117	3ogkA.pdb.gz	Jasmonate perception by inositol-phosphate-potentiated COI1-JAZ co-receptor.
17	PDB:6sgaFS	0.157	0.258	1.153E-2	277	0.041	0.069	6sgaFS.pdb.gz	Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.
18	PDB:7f3fA	0.174	0.176	2.105E-2	460	0.039	0.039	7f3fA.pdb.gz
19	PDB:7phhA	0.148	0.173	2.375E-2	396	0.036	0.043	7phhA.pdb.gz
20	PDB:3lutB	0.144	0.171	3.021E-2	390	0.036	0.044	3lutB.pdb.gz	Structure of the full-length Shaker potassium channel Kv1.2 by normal-mode-based X-ray crystallographic refinement.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43298	0.0	983	467	1.000	1.000	ZBT43_HUMAN Zinc finger and BTB domain-containing protein 43 OS=Homo sapiens OX=9606 GN=ZBTB43 PE=1 SV=1
2	O15209	8.89e-48	176	634	0.238	0.175	ZBT22_HUMAN Zinc finger and BTB domain-containing protein 22 OS=Homo sapiens OX=9606 GN=ZBTB22 PE=1 SV=1
3	Q5TC79	2.70e-37	145	503	0.146	0.135	ZBT37_HUMAN Zinc finger and BTB domain-containing protein 37 OS=Homo sapiens OX=9606 GN=ZBTB37 PE=2 SV=1
4	Q96C00	7.18e-33	132	473	0.126	0.125	ZBTB9_HUMAN Zinc finger and BTB domain-containing protein 9 OS=Homo sapiens OX=9606 GN=ZBTB9 PE=1 SV=1
5	A0A0C4DFQ2	3.33e-32	130	504	0.135	0.125	A0A0C4DFQ2_HUMAN Zinc finger and BTB domain containing 34 OS=Homo sapiens OX=9606 GN=ZBTB34 PE=1 SV=1
6	Q8NCN2	4.36e-32	130	500	0.128	0.120	ZBT34_HUMAN Zinc finger and BTB domain-containing protein 34 OS=Homo sapiens OX=9606 GN=ZBTB34 PE=1 SV=4
7	Q99592	2.02e-25	111	522	0.304	0.272	ZBT18_HUMAN Zinc finger and BTB domain-containing protein 18 OS=Homo sapiens OX=9606 GN=ZBTB18 PE=1 SV=1
8	Q9WUK6	6.15e-25	109	522	0.300	0.268	ZBT18_MOUSE Zinc finger and BTB domain-containing protein 18 OS=Mus musculus OX=10090 GN=Zbtb18 PE=1 SV=1
9	Q96RE7	7.63e-24	106	527	0.120	0.106	NACC1_HUMAN Nucleus accumbens-associated protein 1 OS=Homo sapiens OX=9606 GN=NACC1 PE=1 SV=1
10	Q9HCK0	1.43e-23	105	441	0.103	0.109	ZBT26_HUMAN Zinc finger and BTB domain-containing protein 26 OS=Homo sapiens OX=9606 GN=ZBTB26 PE=1 SV=2
11	Q9Y330	4.94e-23	103	459	0.111	0.113	ZBT12_HUMAN Zinc finger and BTB domain-containing protein 12 OS=Homo sapiens OX=9606 GN=ZBTB12 PE=1 SV=1
12	Q15916	6.74e-23	102	424	0.109	0.120	ZBTB6_HUMAN Zinc finger and BTB domain-containing protein 6 OS=Homo sapiens OX=9606 GN=ZBTB6 PE=1 SV=1
13	O35260	9.96e-23	103	514	0.118	0.107	NACC1_RAT Nucleus accumbens-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Nacc1 PE=1 SV=1
14	Q7TSZ8	9.96e-23	103	514	0.118	0.107	NACC1_MOUSE Nucleus accumbens-associated protein 1 OS=Mus musculus OX=10090 GN=Nacc1 PE=1 SV=1
15	Q96BF6	5.78e-22	101	587	0.111	0.089	NACC2_HUMAN Nucleus accumbens-associated protein 2 OS=Homo sapiens OX=9606 GN=NACC2 PE=1 SV=1
16	Q8NCP5	3.46e-21	98.6	570	0.263	0.216	ZBT44_HUMAN Zinc finger and BTB domain-containing protein 44 OS=Homo sapiens OX=9606 GN=ZBTB44 PE=1 SV=1
17	Q99MD8	1.15e-20	97.4	610	0.229	0.175	MYNN_MOUSE Myoneurin OS=Mus musculus OX=10090 GN=Mynn PE=2 SV=2
18	Q9HC78	5.72e-20	95.5	741	0.096	0.061	ZBT20_HUMAN Zinc finger and BTB domain-containing protein 20 OS=Homo sapiens OX=9606 GN=ZBTB20 PE=1 SV=3
19	Q8K0L9	6.72e-20	95.1	741	0.096	0.061	ZBT20_MOUSE Zinc finger and BTB domain-containing protein 20 OS=Mus musculus OX=10090 GN=Zbtb20 PE=1 SV=1
20	Q9NPC7	1.61e-18	90.5	610	0.221	0.169	MYNN_HUMAN Myoneurin OS=Homo sapiens OX=9606 GN=MYNN PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00651 BTB	3.3e-23	93.4	BTB/POZ domain
2	PF00096 zf-C2H2	0.0083	27.7	Zinc finger, C2H2 type
3	PF13894 zf-C2H2_4	3.9	19.6	C2H2-type zinc finger
4	PF15909 zf-C2H2_8	3.5e+02	13.0	C2H2-type zinc ribbon
5	PF13465 zf-H2C2_2	7e-06	37.4	Zinc-finger double domain
6	PF12874 zf-met	7.1e+02	12.0	Zinc-finger of C2H2 type
7	PF17283 Zn_ribbon_SprT	27	16.2	SprT-like zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362563

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354772	0.800	Multivesicular body subunit 12B
2	9606.ENSP00000299709	0.691	Putative sodium-coupled neutral amino acid transporter 8
3	9606.ENSP00000364589	0.688	Cullin-4A
4	9606.ENSP00000307449	0.678	N-terminal EF-hand calcium-binding protein 2
5	9606.ENSP00000310661	0.640	cAMP-specific 3',5'-cyclic phosphodiesterase 7B
6	9606.ENSP00000372313	0.621	Mesothelin
7	9606.ENSP00000358033	0.617	Decaprenyl-diphosphate synthase subunit 2
8	9606.ENSP00000356480	0.592	E3 ubiquitin-protein ligase RING2
9	9606.ENSP00000351575	0.588	Transcription factor TFIIIB component B'' homolog
10	9606.ENSP00000297792	0.586	Lysine-specific histone demethylase 1B
11	9606.ENSP00000384849	0.577	Cyclin-dependent kinase inhibitor 1
12	9606.ENSP00000404658	0.526	Histone-lysine N-methyltransferase EZH1
13	9606.ENSP00000273283	0.523	Inter-alpha-trypsin inhibitor heavy chain H1
14	9606.ENSP00000358159	0.522	Activating signal cointegrator 1 complex subunit 3
15	9606.ENSP00000379412	0.516	Zinc finger NFX1-type containing 1
16	9606.ENSP00000356234	0.513	Lysine-specific demethylase 5B
17	9606.ENSP00000301764	0.512	DNA damage-binding protein 1
18	9606.ENSP00000269385	0.507	Chromobox protein homolog 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008134	1.000	transcription factor binding
GO:1990837	0.999	sequence-specific double-stranded DNA binding
GO:0140296	0.994	general transcription initiation factor binding
GO:0140110	0.667	transcription regulator activity
GO:0001025	0.512	RNA polymerase III general transcription initiation factor binding
GO:0003700	0.340	DNA-binding transcription factor activity
GO:0000976	0.317	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0031326	0.989	regulation of cellular biosynthetic process
GO:0010556	0.988	regulation of macromolecule biosynthetic process
GO:0019219	0.988	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.981	regulation of gene expression
GO:0051252	0.976	regulation of RNA metabolic process
GO:2001141	0.966	regulation of RNA biosynthetic process
GO:0006355	0.930	regulation of DNA-templated transcription
GO:0009987	0.725	cellular process
GO:0048519	0.717	negative regulation of biological process
GO:0048523	0.687	negative regulation of cellular process
GO:0051172	0.506	negative regulation of nitrogen compound metabolic process
GO:0010605	0.503	negative regulation of macromolecule metabolic process
GO:0031324	0.473	negative regulation of cellular metabolic process
GO:0051253	0.388	negative regulation of RNA metabolic process
GO:0010558	0.382	negative regulation of macromolecule biosynthetic process
GO:0031327	0.382	negative regulation of cellular biosynthetic process
GO:0048518	0.329	positive regulation of biological process
GO:0006357	0.322	regulation of transcription by RNA polymerase II
GO:0045892	0.316	negative regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.996	nucleoplasm
GO:0005737	0.593	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]