StarFunc result for job id O43303

User Input

>input (1012 residues)
MEEYEKFCEKSLARIQEASLSTESFLPAQSESISLIRFHGVAILSPLLNIEKRKEMQQEK
QKALDVEARKQVNRKKALLTRVQEILDNVQVRKAPNASDFDQWEMETVYSNSEVRNLNVP
ATFPNSFPSHTEHSTAAKLDKIAGILPLDNEDQCKTDGIDLARDSEGFNSPKQCDSSNIS
HVENEAFPKTSSATPQETLISDGPFSVNEQQDLPLLAEVIPDPYVMSLQNLMKKSKEYIE
REQSRRSLRGSINRIVNESHLDKEHDAVEVADCVKEKGQLTGKHCVSVIPDKPSLNKSNV
LLQGASTQASSMSMPVLASFSKVDIPIRTGHPTVLESNSDFKVIPTFVTENNVIKSLTGS
YAKLPSPEPSMSPKMHRRRSRTSSACHILINNPINACELSPKGKEQAMDLIIQDTDENTN
VPEIMPKLPTDLAGVCSSKVYVGKNTSEVKEDVVLGKSNQVCQSSGNHLENKVTHGLVTV
EGQLTSDERGAHIMNSTCAAMPKLHEPYASSQCIASPNFGTVSGLKPASMLEKNCSLQTE
LNKSYDVKNPSPLLMQNQNTRQQMDTPMVSCGNEQFLDNSFEKVKRRLDLDIDGLQKENC
PYVITSGITEQERQHLPEKRYPKGSGFVNKNKMLGTSSKESEELLKSKMLAFEEMRKRLE
EQHAQQLSLLIAEQEREQERLQKEIEEQEKMLKEKKAMTAEASELDINNAVELEWRKISD
SSLLETMLSQADSLHTSNSNSSGFTNSAMQYSFVSANEAPFYLWGSSTSGLTKLSVTRPF
GRAKTRWSQVFSLEIQAKFNKITAVAKGFLTRRLMQTDKLKQLRQTVKDTMEFIRSFQSE
APLKRGIVSAQDASLQERVLAQLRAALYGIHDIFFVMDAAERMSILHHDREVRKEKMLRQ
MDKMKSPRVALSAATQKSLDRKKYMKAAEMGMPNKKFLVKQNPSETRVLQPNQGQNAPVH
RLLSRQGTPKTSVKGVVQNRQKPSQSRVPNRVPVSGVYAGKIQRKRPNVATI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43303	1.000	1.000	0.000	1012	1.000	1.000	O43303.pdb.gz	CP110_HUMAN Centriolar coiled-coil protein of 110 kDa OS=Homo sapiens OX=9606 GN=CCP110 PE=1 SV=3
2	AFDB:Q7TSH4	0.359	0.361	2.438E-99	1004	0.725	0.731	Q7TSH4.pdb.gz	CP110_MOUSE Centriolar coiled-coil protein of 110 kDa OS=Mus musculus OX=10090 GN=Ccp110 PE=1 SV=1
3	AFDB:Q4G5U8	0.073	0.092	2.175E-4	780	0.129	0.168	Q4G5U8.pdb.gz
4	AFDB:Q5T5Y3	0.054	0.040	1.054E-3	1602	0.125	0.079	Q5T5Y3.pdb.gz	CAMP1_HUMAN Calmodulin-regulated spectrin-associated protein 1 OS=Homo sapiens OX=9606 GN=CAMSAP1 PE=1 SV=2
5	AFDB:D3ZRA6	0.051	0.034	2.551E-3	1683	0.142	0.086	D3ZRA6.pdb.gz	D3ZRA6_RAT Trinucleotide repeat containing adaptor 6C OS=Rattus norvegicus OX=10116 GN=Tnrc6c PE=1 SV=4
6	AFDB:Q86AD8	0.043	0.039	7.461E-3	1207	0.119	0.099	Q86AD8.pdb.gz	Q86AD8_DICDI RING zinc finger-containing protein OS=Dictyostelium discoideum OX=44689 GN=DG1106 PE=4 SV=1
7	AFDB:Q9SU08	0.061	0.068	7.947E-3	904	0.127	0.143	Q9SU08.pdb.gz	AUXI1_ARATH Auxilin-related protein 1 OS=Arabidopsis thaliana OX=3702 GN=AUXI1 PE=1 SV=2
8	AFDB:F4IZM8	0.051	0.041	9.017E-3	1347	0.143	0.108	F4IZM8.pdb.gz	HUAL3_ARATH Protein HUA2-LIKE 3 OS=Arabidopsis thaliana OX=3702 GN=HULK3 PE=2 SV=1
9	AFDB:Q6AI39	0.044	0.042	1.090E-2	1079	0.131	0.123	Q6AI39.pdb.gz	BICRL_HUMAN BRD4-interacting chromatin-remodeling complex-associated protein-like OS=Homo sapiens OX=9606 GN=BICRAL PE=1 SV=2
10	AFDB:D3ZAG3	0.063	0.090	1.317E-2	646	0.112	0.175	D3ZAG3.pdb.gz	D3ZAG3_RAT Microtubule-associated protein 9 OS=Rattus norvegicus OX=10116 GN=Map9 PE=1 SV=1
11	PDB:7bylA	0.070	0.171	1.998	354	0.013	0.037	7bylA.pdb.gz	Structural Basis for the Modulation of Human KCNQ4 by Small-Molecule Drugs.
12	PDB:7enag	0.057	0.266	1.998	166	0.019	0.114	7enag.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
13	PDB:5nrlA	0.040	0.022	2.129	2216	0.018	0.008	5nrlA.pdb.gz	Structure of a pre-catalytic spliceosome.
14	PDB:7ungC4	0.050	0.190	2.267	219	0.024	0.110	7ungC4.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
15	PDB:2b5uA	0.054	0.108	2.573	470	0.025	0.053	2b5uA.pdb.gz
16	PDB:4n78F	0.049	0.192	3.109	156	0.022	0.141	4n78F.pdb.gz	The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton.
17	PDB:3k29A	0.039	0.181	3.312	162	0.022	0.136	3k29A.pdb.gz
18	PDB:7nsuD	0.051	0.098	3.312	420	0.023	0.055	7nsuD.pdb.gz
19	PDB:6mdmH	0.043	0.183	3.527	147	0.020	0.136	6mdmH.pdb.gz	Structural principles of SNARE complex recognition by the AAA+ protein NSF.
20	PDB:5x6oG	0.041	0.057	3.757	704	0.015	0.021	5x6oG.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43303	0.0	2098	1012	1.000	1.000	CP110_HUMAN Centriolar coiled-coil protein of 110 kDa OS=Homo sapiens OX=9606 GN=CCP110 PE=1 SV=3
2	Q7TSH4	0.0	1425	1004	0.728	0.734	CP110_MOUSE Centriolar coiled-coil protein of 110 kDa OS=Mus musculus OX=10090 GN=Ccp110 PE=1 SV=1
3	Q2PDW6	1.83e-09	63.9	666	0.041	0.062	Q2PDW6_DROME Centriolar coiled coil protein 110kDa, isoform B OS=Drosophila melanogaster OX=7227 GN=Cp110 PE=4 SV=1
4	Q8QFX6	0.43	37.0	923	0.020	0.022	NRP1A_DANRE Neuropilin-1a OS=Danio rerio OX=7955 GN=nrp1a PE=2 SV=1
5	P32456	1.4	35.0	591	0.023	0.039	GBP2_HUMAN Guanylate-binding protein 2 OS=Homo sapiens OX=9606 GN=GBP2 PE=1 SV=3
6	Q5AB80	2.1	34.7	1018	0.028	0.028	Q5AB80_CANAL Kel1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=KEL1 PE=4 SV=1
7	Q8I4T3	2.7	34.7	3119	0.047	0.015	Q8I4T3_PLAF7 Osmiophilic body protein G377 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1250100 PE=4 SV=1
8	F4IFY5	3.3	33.1	212	0.033	0.156	F4IFY5_ARATH DNA ligase-like protein OS=Arabidopsis thaliana OX=3702 GN=ASY4 PE=4 SV=1
9	Q50L36	3.9	33.9	595	0.014	0.024	ISPS_POPAL Isoprene synthase, chloroplastic OS=Populus alba OX=43335 GN=ISPS PE=1 SV=1
10	P19474	5.6	33.1	475	0.017	0.036	RO52_HUMAN E3 ubiquitin-protein ligase TRIM21 OS=Homo sapiens OX=9606 GN=TRIM21 PE=1 SV=1
11	Q38ER6	5.8	33.1	595	0.029	0.049	Q38ER6_TRYB2 Flavoprotein monooxygenase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.4910 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16025 CaM_bind	1.1e-16	72.4	Calcium-dependent calmodulin binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000370803

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000342510	0.999	Centrosomal protein of 97 kDa
2	9606.ENSP00000448012	0.997	Centrosomal protein of 290 kDa
3	9606.ENSP00000380256	0.981	Cyclin-F
4	9606.ENSP00000368464	0.972	Kinesin-like protein KIF24
5	9606.ENSP00000371308	0.951	Centromere protein J
6	9606.ENSP00000262127	0.936	Centrosomal protein of 76 kDa
7	9606.ENSP00000287482	0.933	Spindle assembly abnormal protein 6 homolog
8	9606.ENSP00000257287	0.932	Centrosomal protein of 135 kDa
9	9606.ENSP00000270861	0.930	Serine/threonine-protein kinase PLK4
10	9606.ENSP00000382390	0.929	Neuralized-like protein 4
11	9606.ENSP00000409581	0.910	Beta-arrestin-1
12	9606.ENSP00000403701	0.901	Beta-arrestin-2
13	9606.ENSP00000370337	0.886	Centrosomal protein of 152 kDa
14	9606.ENSP00000359829	0.881	Ubiquitin carboxyl-terminal hydrolase 33
15	9606.ENSP00000367476	0.875	Centrosomal protein of 104 kDa
16	9606.ENSP00000352572	0.861	Pericentrin
17	9606.ENSP00000278935	0.848	Centrosomal protein of 164 kDa
18	9606.ENSP00000300935	0.848	Ras-related protein Rab-8A
19	9606.ENSP00000267890	0.841	Tau-tubulin kinase 2
20	9606.ENSP00000251413	0.809	Tubulin gamma-1 chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0050794	0.993	regulation of cellular process
GO:0006996	0.976	organelle organization
GO:0022607	0.955	cellular component assembly
GO:0070925	0.940	organelle assembly
GO:0007098	0.923	centrosome cycle
GO:0051302	0.906	regulation of cell division
GO:0010564	0.890	regulation of cell cycle process
GO:0033043	0.878	regulation of organelle organization
GO:1902115	0.869	regulation of organelle assembly
GO:0140694	0.862	non-membrane-bounded organelle assembly
GO:0007099	0.851	centriole replication
GO:0032465	0.798	regulation of cytokinesis
GO:1902017	0.795	regulation of cilium assembly
GO:0048519	0.695	negative regulation of biological process
GO:0048523	0.690	negative regulation of cellular process
GO:1902116	0.644	negative regulation of organelle assembly
GO:0120033	0.587	negative regulation of plasma membrane bounded cell projection assembly
GO:0048518	0.379	positive regulation of biological process
GO:0048522	0.362	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005814	0.999	centriole
GO:0005813	0.999	centrosome
GO:0005829	0.998	cytosol
GO:0032991	0.995	protein-containing complex
GO:0043227	0.592	membrane-bounded organelle
GO:0043231	0.547	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]