StarFunc result for job id O43306

User Input

>input (1168 residues)
MSWFSGLLVPKVDERKTAWGERNGQKRSRRRGTRAGGFCTPRYMSCLRDAEPPSPTPAGP
PRCPWQDDAFIRRGGPGKGKELGLRAVALGFEDTEVTTTAGGTAEVAPDAVPRSGRSCWR
RLVQVFQSKQFRSAKLERLYQRYFFQMNQSSLTLLMAVLVLLTAVLLAFHAAPARPQPAY
VALLACAAALFVGLMVVCNRHSFRQDSMWVVSYVVLGILAAVQVGGALAADPRSPSAGLW
CPVFFVYIAYTLLPIRMRAAVLSGLGLSTLHLILAWQLNRGDAFLWKQLGANVLLFLCTN
VIGICTHYPAEVSQRQAFQETRGYIQARLHLQHENRQQERLLLSVLPQHVAMEMKEDINT
KKEDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHC
LRIKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRV
HCGVLGLRKWQFDVWSNDVTLANHMEAGGRAGRIHITRATLQYLNGDYEVEPGRGGERNA
YLKEQHIETFLILGASQKRKEEKAMLAKLQRTRANSMEGLMPRWVPDRAFSRTKDSKAFR
QMGIDDSSKDNRGTQDALNPEDEVDEFLSRAIDARSIDQLRKDHVRRFLLTFQREDLEKK
YSRKVDPRFGAYVACALLVFCFICFIQLLIFPHSTLMLGIYASIFLLLLITVLICAVYSC
GSLFPKALQRLSRSIVRSRAHSTAVGIFSVLLVFTSAIANMFTCNHTPIRSCAARMLNLT
PADITACHLQQLNYSLGLDAPLCEGTMPTCSFPEYFIGNMLLSLLASSVFLHISSIGKLA
MIFVLGLIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKYMTPV
ILLVFALALYLHAQQVESTARLDFLWKLQATGEKEEMEELQAYNRRLLHNILPKDVAAHF
LARERRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIIS
EERFRQLEKIKTIGSTYMAASGLNASTYDQVGRSHITALADYAMRLMEQMKHINEHSFNN
FQMKIGLNMGPVVAGVIGARKPQYDIWGNTVNVSSRMDSTGVPDRIQVTTDLYQVLAAKG
YQLECRGVVKVKGKGEMTTYFLNGGPSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B3KWA8	0.732	0.926	0.000	919	0.568	0.721	B3KWA8.pdb.gz	B3KWA8_HUMAN adenylate cyclase OS=Homo sapiens OX=9606 GN=ADCY5 PE=1 SV=1
2	AFDB:D2CFN3	0.873	0.860	0.000	1186	0.658	0.648	D2CFN3.pdb.gz	D2CFN3_DANRE adenylate cyclase OS=Danio rerio OX=7955 GN=si:dkey-178j17.2 PE=2 SV=1
3	AFDB:E9QDH0	0.855	0.857	0.000	1165	0.716	0.718	E9QDH0.pdb.gz
4	AFDB:O43306	1.000	1.000	0.000	1168	1.000	1.000	O43306.pdb.gz	ADCY6_HUMAN Adenylate cyclase type 6 OS=Homo sapiens OX=9606 GN=ADCY6 PE=1 SV=2
5	AFDB:P30803	0.884	0.817	0.000	1265	0.670	0.619	P30803.pdb.gz	ADCY5_CANLF Adenylate cyclase type 5 OS=Canis lupus familiaris OX=9615 GN=ADCY5 PE=1 SV=2
6	AFDB:B7UCF8	0.755	0.722	1.425E-80	1225	0.385	0.367	B7UCF8.pdb.gz	B7UCF8_DANRE adenylate cyclase OS=Danio rerio OX=7955 GN=si:ch211-220f13.4 PE=2 SV=1
7	AFDB:D1MIA3	0.721	0.754	3.394E-80	1114	0.371	0.389	D1MIA3.pdb.gz	D1MIA3_DANRE adenylate cyclase OS=Danio rerio OX=7955 GN=ADCY1b PE=2 SV=1
8	AFDB:Q08462	0.738	0.787	7.723E-79	1091	0.351	0.376	Q08462.pdb.gz	ADCY2_HUMAN Adenylate cyclase type 2 OS=Homo sapiens OX=9606 GN=ADCY2 PE=1 SV=5
9	AFDB:Q8NFM4	0.742	0.802	4.165E-75	1077	0.348	0.377	Q8NFM4.pdb.gz	ADCY4_HUMAN Adenylate cyclase type 4 OS=Homo sapiens OX=9606 GN=ADCY4 PE=1 SV=1
10	AFDB:Q29450	0.717	0.774	1.595E-73	1078	0.332	0.360	Q29450.pdb.gz	ADCY7_BOVIN Adenylate cyclase type 7 OS=Bos taurus OX=9913 GN=ADCY7 PE=2 SV=1
11	PDB:7yziA	0.193	0.552	1.591E-14	378	0.081	0.251	7yziA.pdb.gz	Structure of Mycobacterium tuberculosis Cya, an evolutionary ancestor of the mammalian membrane adenylyl cyclases.
12	PDB:7d9tA	0.161	0.354	1.879E-11	512	0.058	0.133	7d9tA.pdb.gz	Activation mechanism of human soluble guanylate cyclase by stimulators and activators.
13	PDB:6jt0A	0.182	0.380	2.658E-11	542	0.060	0.129	6jt0A.pdb.gz	Structural insights into the mechanism of human soluble guanylate cyclase.
14	PDB:7d9rA	0.180	0.403	3.028E-11	502	0.059	0.137	7d9rA.pdb.gz	Activation mechanism of human soluble guanylate cyclase by stimulators and activators.
15	PDB:6jt0B	0.184	0.357	6.063E-11	576	0.063	0.128	6jt0B.pdb.gz	Structural insights into the mechanism of human soluble guanylate cyclase.
16	PDB:1y11A	0.140	0.402	1.705E-7	364	0.046	0.148	1y11A.pdb.gz
17	PDB:5ykfB	0.105	0.097	6.770E-3	1309	0.106	0.095	5ykfB.pdb.gz	Ligand binding and conformational changes of SUR1 subunit in pancreatic ATP-sensitive potassium channels.
18	PDB:5w81A	0.076	0.075	5.205E-2	1173	0.092	0.091	5w81A.pdb.gz	Conformational Changes of CFTR upon Phosphorylation and ATP Binding.
19	PDB:4h54A	0.098	0.337	6.753E-2	274	0.032	0.135	4h54A.pdb.gz	Structure and signaling mechanism of a zinc-sensory diguanylate cyclase.
20	PDB:5ykeB	0.082	0.097	8.389E-2	845	0.082	0.114	5ykeB.pdb.gz	Ligand binding and conformational changes of SUR1 subunit in pancreatic ATP-sensitive potassium channels.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A384P5Q5	1519	1261	0.665	0.616	A0A384P5Q5_HUMAN adenylate cyclase OS=Homo sapiens OX=9606 PE=2 SV=1
2	B3KWA8	1344	919	0.572	0.727	B3KWA8_HUMAN adenylate cyclase OS=Homo sapiens OX=9606 GN=ADCY5 PE=1 SV=1
3	B7UCF8	734	1225	0.379	0.362	B7UCF8_DANRE adenylate cyclase OS=Danio rerio OX=7955 GN=si:ch211-220f13.4 PE=2 SV=1
4	C9JRT8	1250	820	0.529	0.754	C9JRT8_HUMAN Adenylate cyclase 5 OS=Homo sapiens OX=9606 GN=ADCY5 PE=1 SV=2
5	D2CFN3	1549	1186	0.666	0.656	D2CFN3_DANRE adenylate cyclase OS=Danio rerio OX=7955 GN=si:dkey-178j17.2 PE=2 SV=1
6	D4A3N4	727	1119	0.368	0.384	D4A3N4_RAT Adenylate cyclase type 1 OS=Rattus norvegicus OX=10116 GN=Adcy1 PE=1 SV=3
7	F1LQT1	620	1100	0.350	0.372	F1LQT1_RAT Adenylate cyclase type 7 OS=Rattus norvegicus OX=10116 GN=Adcy7 PE=3 SV=2
8	G0TC75	654	982	0.329	0.391	G0TC75_BOVIN adenylate cyclase OS=Bos taurus OX=9913 GN=ADCY2 PE=2 SV=1
9	O43306	2428	1168	1.000	1.000	ADCY6_HUMAN Adenylate cyclase type 6 OS=Homo sapiens OX=9606 GN=ADCY6 PE=1 SV=2
10	O60266	635	1144	0.342	0.350	ADCY3_HUMAN Adenylate cyclase type 3 OS=Homo sapiens OX=9606 GN=ADCY3 PE=1 SV=3
11	O88444	728	1118	0.366	0.383	ADCY1_MOUSE Adenylate cyclase type 1 OS=Mus musculus OX=10090 GN=Adcy1 PE=1 SV=2
12	O95622	1519	1261	0.665	0.616	ADCY5_HUMAN Adenylate cyclase type 5 OS=Homo sapiens OX=9606 GN=ADCY5 PE=1 SV=3
13	P19754	740	1134	0.357	0.368	ADCY1_BOVIN Adenylate cyclase type 1 OS=Bos taurus OX=9913 GN=ADCY1 PE=1 SV=1
14	P21932	632	1144	0.342	0.350	ADCY3_RAT Adenylate cyclase type 3 OS=Rattus norvegicus OX=10116 GN=Adcy3 PE=1 SV=1
15	P26769	710	1090	0.358	0.383	ADCY2_RAT Adenylate cyclase type 2 OS=Rattus norvegicus OX=10116 GN=Adcy2 PE=1 SV=1
16	P26770	628	1064	0.342	0.375	ADCY4_RAT Adenylate cyclase type 4 OS=Rattus norvegicus OX=10116 GN=Adcy4 PE=1 SV=1
17	P30803	1510	1265	0.662	0.611	ADCY5_CANLF Adenylate cyclase type 5 OS=Canis lupus familiaris OX=9615 GN=ADCY5 PE=1 SV=2
18	P40145	750	1251	0.384	0.359	ADCY8_HUMAN Adenylate cyclase type 8 OS=Homo sapiens OX=9606 GN=ADCY8 PE=1 SV=1
19	P40146	749	1248	0.385	0.361	ADCY8_RAT Adenylate cyclase type 8 OS=Rattus norvegicus OX=10116 GN=Adcy8 PE=1 SV=1
20	P51828	629	1080	0.354	0.383	ADCY7_HUMAN Adenylate cyclase type 7 OS=Homo sapiens OX=9606 GN=ADCY7 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16214 AC_N	4.3e-120	413.3	Adenylyl cyclase N-terminal extracellular and transmembrane region
2	PF06327 Adcy_cons_dom	4.1e-11	54.7	Adenylate cyclase, conserved domain
3	PF18455 GBR2_CC	2.7e+02	12.8	Gamma-aminobutyric acid type B receptor subunit 2 coiled-coil domain
4	PF00211 Guanylate_cyc	2.7e-117	400.5	Adenylate and Guanylate cyclase catalytic domain
5	PF07701 HNOBA	19	16.1	Heme NO binding associated
6	PF13908 Shisa	1.4e+02	13.9	Wnt and FGF inhibitory regulator
7	PF18396 TBK1_ULD	1.2e+02	13.9	TANK binding kinase 1 ubiquitin-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000311405

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360141	0.978	Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas
2	9606.ENSP00000378207	0.972	A-kinase anchor protein 5
3	9606.ENSP00000334051	0.952	Guanine nucleotide-binding protein G(olf) subunit alpha
4	9606.ENSP00000262494	0.943	Guanine nucleotide-binding protein G(o) subunit alpha
5	9606.ENSP00000294016	0.943	Adenylate cyclase type 9
6	9606.ENSP00000312126	0.941	Adenylate cyclase type 4
7	9606.ENSP00000343027	0.940	Guanine nucleotide-binding protein G(i) subunit alpha-1
8	9606.ENSP00000378187	0.940	Adenylate cyclase type 7
9	9606.ENSP00000478892	0.940	Guanine nucleotide-binding protein G(z) subunit alpha
10	9606.ENSP00000312999	0.939	Guanine nucleotide-binding protein G(i) subunit alpha-2
11	9606.ENSP00000342952	0.936	Adenylate cyclase type 2
12	9606.ENSP00000358867	0.930	Guanine nucleotide-binding protein G(k) subunit alpha
13	9606.ENSP00000260600	0.914	Adenylate cyclase type 3
14	9606.ENSP00000306124	0.914	Protein kinase C epsilon type
15	9606.ENSP00000368683	0.911	Endothelin-1
16	9606.ENSP00000286355	0.910	Adenylate cyclase type 8
17	9606.ENSP00000315011	0.908	Endothelin-1 receptor
18	9606.ENSP00000419361	0.907	Adenylate cyclase type 5
19	9606.ENSP00000297323	0.906	Adenylate cyclase type 1
20	9606.ENSP00000370078	0.878	cAMP-specific 3',5'-cyclic phosphodiesterase 4A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004016	1.000	adenylate cyclase activity
GO:0005515	0.999	protein binding
GO:0019901	0.981	protein kinase binding
GO:0005080	0.954	protein kinase C binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050896	0.988	response to stimulus
GO:1901576	0.988	organic substance biosynthetic process
GO:0044249	0.988	cellular biosynthetic process
GO:0050794	0.987	regulation of cellular process
GO:0052652	0.985	cyclic purine nucleotide metabolic process
GO:0009150	0.985	purine ribonucleotide metabolic process
GO:0046058	0.983	cAMP metabolic process
GO:0072522	0.976	purine-containing compound biosynthetic process
GO:0009260	0.976	ribonucleotide biosynthetic process
GO:0009190	0.974	cyclic nucleotide biosynthetic process
GO:0009152	0.968	purine ribonucleotide biosynthetic process
GO:0051716	0.881	cellular response to stimulus
GO:0032501	0.829	multicellular organismal process
GO:0007186	0.827	G protein-coupled receptor signaling pathway
GO:0007188	0.773	adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0042221	0.703	response to chemical
GO:0007189	0.676	adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0010033	0.620	response to organic substance
GO:1901700	0.325	response to oxygen-containing compound
GO:0065008	0.324	regulation of biological quality
GO:0003008	0.321	system process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.876	intracellular anatomical structure
GO:0043226	0.845	organelle
GO:0043229	0.798	intracellular organelle
GO:0043227	0.787	membrane-bounded organelle
GO:0005737	0.611	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:15389	1.000	ATP = 3',5'-cyclic AMP + diphosphate
EC:4.6.1.1	1.000	adenylate cyclase.

[back to server]