StarFunc result for job id O43307

User Input

>input (516 residues)
MTLLITGDSIVSAEAVWDHVTMANRELAFKAGDVIKVLDASNKDWWWGQIDDEEGWFPAS
FVRLWVNQEDEVEEGPSDVQNGHLDPNSDCLCLGRPLQNRDQMRANVINEIMSTERHYIK
HLKDICEGYLKQCRKRRDMFSDEQLKVIFGNIEDIYRFQMGFVRDLEKQYNNDDPHLSEI
GPCFLEHQDGFWIYSEYCNNHLDACMELSKLMKDSRYQHFFEACRLLQQMIDIAIDGFLL
TPVQKICKYPLQLAELLKYTAQDHSDYRYVAAALAVMRNVTQQINERKRRLENIDKIAQW
QASVLDWEGEDILDRSSELIYTGEMAWIYQPYGRNQQRVFFLFDHQMVLCKKDLIRRDIL
YYKGRIDMDKYEVVDIEDGRDDDFNVSMKNAFKLHNKETEEIHLFFAKKLEEKIRWLRAF
REERKMVQEDEKIGFEISENQKRQAAMTVRKVPKQKGVNSARSVPPSYPPPQDPLNHGQY
LVPDGIAQSQVFEFTEPKRSQSPFWQNFSRLTPFKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0A6YYF8	0.728	0.668	8.378E-80	564	0.990	0.906	A0A0A6YYF8.pdb.gz	A0A0A6YYF8_HUMAN Rho guanine nucleotide exchange factor 9 OS=Homo sapiens OX=9606 GN=ARHGEF9 PE=1 SV=1
2	AFDB:A0A2R8QCF3	0.844	0.793	7.041E-73	550	0.839	0.787	A0A2R8QCF3.pdb.gz
3	AFDB:A0A5F9ZI31	0.760	0.865	3.108E-62	451	0.874	1.000	A0A5F9ZI31.pdb.gz	A0A5F9ZI31_HUMAN Cdc42 guanine nucleotide exchange factor 9 OS=Homo sapiens OX=9606 GN=ARHGEF9 PE=1 SV=1
4	AFDB:A0A024RDM6	0.805	0.643	4.974E-59	652	0.609	0.482	A0A024RDM6.pdb.gz	A0A024RDM6_HUMAN SPATA13 (Fragment) OS=Homo sapiens OX=9606 GN=SPATA13 PE=4 SV=1
5	AFDB:Q9NR80	0.812	0.612	4.852E-58	690	0.587	0.439	Q9NR80.pdb.gz	ARHG4_HUMAN Rho guanine nucleotide exchange factor 4 OS=Homo sapiens OX=9606 GN=ARHGEF4 PE=1 SV=3
6	PDB:4mt6A	0.475	0.623	1.149E-57	389	0.744	0.987	4mt6A.pdb.gz
7	AFDB:J3KQJ8	0.608	0.572	5.096E-50	550	0.545	0.511	J3KQJ8.pdb.gz	J3KQJ8_HUMAN Spermatogenesis associated 13 (Fragment) OS=Homo sapiens OX=9606 GN=SPATA13 PE=1 SV=1
8	AFDB:Q9W0S0	0.455	0.254	8.560E-31	1026	0.293	0.147	Q9W0S0.pdb.gz	Q9W0S0_DROME LP23332p OS=Drosophila melanogaster OX=7227 GN=RhoGEF3 PE=2 SV=2
9	AFDB:F1R6J2	0.444	0.169	2.193E-28	1622	0.244	0.078	F1R6J2.pdb.gz	F1R6J2_DANRE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Danio rerio OX=7955 GN=prex1 PE=1 SV=1
10	AFDB:Q70Z35	0.461	0.173	8.773E-28	1606	0.242	0.078	Q70Z35.pdb.gz	PREX2_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein OS=Homo sapiens OX=9606 GN=PREX2 PE=1 SV=1
11	AFDB:Q8TCU6	0.450	0.170	1.589E-27	1659	0.242	0.075	Q8TCU6.pdb.gz	PREX1_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Homo sapiens OX=9606 GN=PREX1 PE=1 SV=3
12	PDB:7rx9A	0.361	0.430	8.104E-26	432	0.240	0.287	7rx9A.pdb.gz
13	PDB:4gouA	0.315	0.320	2.723E-8	507	0.076	0.077	4gouA.pdb.gz
14	PDB:6u3eA	0.187	0.231	4.148E-5	397	0.081	0.106	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
15	PDB:6bbpA	0.174	0.173	7.151E-5	520	0.093	0.092	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
16	PDB:3ljuX	0.172	0.231	1.659E-4	373	0.048	0.067	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
17	PDB:1griA	0.115	0.274	9.389E-4	211	0.039	0.095	1griA.pdb.gz
18	PDB:2lqnA	0.112	0.182	1.328E-3	303	0.037	0.063	2lqnA.pdb.gz
19	PDB:3qwyA	0.110	0.325	1.328E-3	170	0.025	0.076	3qwyA.pdb.gz
20	PDB:1k0xA	0.102	0.451	1.787E-3	108	0.037	0.176	1k0xA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A024RDM6	0.0	649	652	0.616	0.488	A0A024RDM6_HUMAN SPATA13 (Fragment) OS=Homo sapiens OX=9606 GN=SPATA13 PE=4 SV=1
2	A0A0A6YYF8	0.0	1062	564	0.988	0.904	A0A0A6YYF8_HUMAN Rho guanine nucleotide exchange factor 9 OS=Homo sapiens OX=9606 GN=ARHGEF9 PE=1 SV=1
3	A0A1B0GV84	0.0	1022	506	0.948	0.966	A0A1B0GV84_HUMAN Rho guanine nucleotide exchange factor 9 OS=Homo sapiens OX=9606 GN=ARHGEF9 PE=1 SV=1
4	A0A1B0GVC4	0.0	947	454	0.878	0.998	A0A1B0GVC4_HUMAN Cdc42 guanine nucleotide exchange factor 9 OS=Homo sapiens OX=9606 GN=ARHGEF9 PE=1 SV=1
5	A0A1B0GWI5	0.0	1074	529	0.994	0.970	A0A1B0GWI5_HUMAN Rho guanine nucleotide exchange factor 9 OS=Homo sapiens OX=9606 GN=ARHGEF9 PE=1 SV=1
6	A0A5F9ZGZ3	0.0	947	489	0.878	0.926	A0A5F9ZGZ3_HUMAN Cdc42 guanine nucleotide exchange factor 9 OS=Homo sapiens OX=9606 GN=ARHGEF9 PE=1 SV=1
7	A0A5F9ZHY9	0.0	1072	523	0.994	0.981	A0A5F9ZHY9_HUMAN Rho guanine nucleotide exchange factor 9 OS=Homo sapiens OX=9606 GN=ARHGEF9 PE=1 SV=1
8	A0A5F9ZI31	0.0	892	451	0.874	1.000	A0A5F9ZI31_HUMAN Cdc42 guanine nucleotide exchange factor 9 OS=Homo sapiens OX=9606 GN=ARHGEF9 PE=1 SV=1
9	B1AMR3	0.0	1034	495	0.959	1.000	B1AMR3_HUMAN Rho guanine nucleotide exchange factor 9 OS=Homo sapiens OX=9606 GN=ARHGEF9 PE=1 SV=1
10	F1Q628	0.0	907	514	0.839	0.842	F1Q628_DANRE Rho guanine nucleotide exchange factor 9 OS=Danio rerio OX=7955 GN=arhgef9 PE=4 SV=1
11	O43307	0.0	1078	516	1.000	1.000	ARHG9_HUMAN Rho guanine nucleotide exchange factor 9 OS=Homo sapiens OX=9606 GN=ARHGEF9 PE=1 SV=3
12	Q3UTH8	0.0	1061	516	0.984	0.984	ARHG9_MOUSE Rho guanine nucleotide exchange factor 9 OS=Mus musculus OX=10090 GN=Arhgef9 PE=1 SV=1
13	Q96N96	0.0	649	652	0.616	0.488	SPT13_HUMAN Spermatogenesis-associated protein 13 OS=Homo sapiens OX=9606 GN=SPATA13 PE=1 SV=1
14	Q9NR80	0.0	630	690	0.595	0.445	ARHG4_HUMAN Rho guanine nucleotide exchange factor 4 OS=Homo sapiens OX=9606 GN=ARHGEF4 PE=1 SV=3
15	Q9QX73	0.0	933	493	0.864	0.905	ARHG9_RAT Rho guanine nucleotide exchange factor 9 OS=Rattus norvegicus OX=10116 GN=Arhgef9 PE=1 SV=1
16	E9PFR9	6.12e-175	504	512	0.473	0.477	E9PFR9_HUMAN Spermatogenesis associated 13 OS=Homo sapiens OX=9606 GN=SPATA13 PE=1 SV=1
17	J3KQJ8	5.32e-174	503	550	0.473	0.444	J3KQJ8_HUMAN Spermatogenesis associated 13 (Fragment) OS=Homo sapiens OX=9606 GN=SPATA13 PE=1 SV=1
18	Q69ZK0	7.19e-58	210	1650	0.246	0.077	PREX1_MOUSE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Mus musculus OX=10090 GN=Prex1 PE=1 SV=2
19	Q70Z35	2.23e-56	206	1606	0.254	0.082	PREX2_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein OS=Homo sapiens OX=9606 GN=PREX2 PE=1 SV=1
20	Q3LAC4	3.06e-55	202	1598	0.244	0.079	PREX2_MOUSE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein OS=Mus musculus OX=10090 GN=Prex2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00313 CSD	5.1e+02	12.0	'Cold-shock' DNA-binding domain
2	PF00169 PH	0.00096	31.0	PH domain
3	PF00621 RhoGEF	4e-41	152.8	RhoGEF domain
4	PF00018 SH3_1	7.8e-07	39.9	SH3 domain
5	PF07653 SH3_2	5.8e-06	37.3	Variant SH3 domain
6	PF14604 SH3_9	8.9e-05	33.7	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9986.ENSOCUP00000009697

Rank	PPI partner	STRING score	Description
1	9986.ENSOCUP00000025997	0.914	Uncharacterized protein
2	9986.ENSOCUP00000000778	0.890	Catalyzes two steps in the biosynthesis of the molybdenum cofactor. In the first step, molybdopterin is adenylated. Subsequently, molybdate is inserted into adenylated molybdopterin and AMP is released
3	9986.ENSOCUP00000004804	0.869	Neuroligin 2
4	9986.ENSOCUP00000008601	0.863	Uncharacterized protein
5	9986.ENSOCUP00000013849	0.736	Ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2)
6	9986.ENSOCUP00000014390	0.730	Gamma-aminobutyric acid (GABA) A receptor, gamma 2
7	9986.ENSOCUP00000016582	0.725	Ras homolog family member C
8	9986.ENSOCUP00000000979	0.706	Ras homolog family member Q
9	9986.ENSOCUP00000002224	0.694	Gamma-aminobutyric acid (GABA) A receptor, alpha 2
10	9986.ENSOCUP00000010835	0.684	Ras homolog family member U
11	9986.ENSOCUP00000008330	0.665	Spindlin family, member 3
12	9986.ENSOCUP00000004227	0.661	Ras homolog family member V
13	9986.ENSOCUP00000004645	0.661	Ras homolog family member J
14	9986.ENSOCUP00000015118	0.661	Ras homolog family member G
15	9986.ENSOCUP00000018702	0.661	Ras homolog family member F (in filopodia)
16	9986.ENSOCUP00000023639	0.661	Ras homolog family member H
17	9986.ENSOCUP00000012239	0.635	Glycerol kinase 5 (putative)
18	9986.ENSOCUP00000009887	0.634	Secernin 3
19	9986.ENSOCUP00000013607	0.633	Rho-related BTB domain containing 3
20	9986.ENSOCUP00000007530	0.624	Neurite extension and migration factor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005085	1.000	guanyl-nucleotide exchange factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.989	regulation of cellular process
GO:0009987	0.956	cellular process
GO:0007154	0.855	cell communication
GO:0023052	0.829	signaling
GO:0044087	0.647	regulation of cellular component biogenesis
GO:0051128	0.593	regulation of cellular component organization
GO:0050896	0.573	response to stimulus
GO:0033043	0.539	regulation of organelle organization
GO:1902115	0.509	regulation of organelle assembly
GO:1902531	0.488	regulation of intracellular signal transduction
GO:0051716	0.480	cellular response to stimulus
GO:0007165	0.460	signal transduction
GO:0051056	0.399	regulation of small GTPase mediated signal transduction
GO:0048856	0.376	anatomical structure development
GO:0071840	0.361	cellular component organization or biogenesis
GO:0016043	0.338	cellular component organization
GO:0032501	0.330	multicellular organismal process
GO:0035556	0.323	intracellular signal transduction
GO:0007264	0.300	small GTPase mediated signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005829	0.988	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]