StarFunc result for job id O43312

User Input

>input (755 residues)
MEAVIEKECSALGGLFQTIISDMKGSYPVWEDFINKAGKLQSQLRTTVVAAAAFLDAFQK
VADMATNTRGGTREIGSALTRMCMRHRSIEAKLRQFSSALIDCLINPLQEQMEEWKKVAN
QLDKDHAKEYKKARQEIKKKSSDTLKLQKKAKKGRGDIQPQLDSALQDVNDKYLLLEETE
KQAVRKALIEERGRFCTFISMLRPVIEEEISMLGEITHLQTISEDLKSLTMDPHKLPSSS
EQVILDLKGSDYSWSYQTPPSSPSTTMSRKSSVCSSLNSVNSSDSRSSGSHSHSPSSHYR
YRSSNLAQQAPVRLSSVSSHDSGFISQDAFQSKSPSPMPPEAPNQLSNGFSHYSLSSESH
VGPTGAGLFPHCLPASRLLPRVTSVHLPDYAHYYTIGPGMFPSSQIPSWKDWAKPGPYDQ
PLVNTLQRRKEKREPDPNGGGPTTASGPPAAAEEAQRPRSMTVSAATRPGEEMEACEELA
LALSRGLQLDTQRSSRDSLQCSSGYSTQTTTPCCSEDTIPSQVSDYDYFSVSGDQEADQQ
EFDKSSTIPRNSDISQSYRRMFQAKRPASTAGLPTTLGPAMVTPGVATIRRTPSTKPSVR
RGTIGAGPIPIKTPVIPVKTPTVPDLPGVLPAPPDGPEERGEHSPESPSVGEGPQGVTSM
PSSMWSGQASVNPPLPGPKPSIPEEHRQAIPESEAEDQEREPPSATVSPGQIPESDPADL
SPRDTPQGEDMLNAIRRGVKLKKTTTNDRSAPRFS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8R1S4	0.606	0.604	1.158E-84	759	0.966	0.960	Q8R1S4.pdb.gz	MTSS1_MOUSE Protein MTSS 1 OS=Mus musculus OX=10090 GN=Mtss1 PE=1 SV=1
2	AFDB:Q765P7	0.411	0.415	5.635E-50	747	0.572	0.578	Q765P7.pdb.gz	MTSS2_HUMAN Protein MTSS 2 OS=Homo sapiens OX=9606 GN=MTSS2 PE=1 SV=1
3	AFDB:Q6P9S0	0.372	0.391	9.822E-49	715	0.564	0.596	Q6P9S0.pdb.gz	MTSS2_MOUSE Protein MTSS 2 OS=Mus musculus OX=10090 GN=Mtss2 PE=1 SV=1
4	AFDB:A0A0B4K822	0.331	0.222	2.165E-26	1136	0.298	0.198	A0A0B4K822.pdb.gz	A0A0B4K822_DROME Missing-in-metastasis, isoform H OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
5	AFDB:A0A0B4KEU9	0.333	0.314	2.538E-26	804	0.298	0.280	A0A0B4KEU9.pdb.gz	A0A0B4KEU9_DROME Missing-in-metastasis, isoform K OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
6	AFDB:A0A0B4JD47	0.332	0.257	4.086E-26	977	0.298	0.230	A0A0B4JD47.pdb.gz	A0A0B4JD47_DROME Missing-in-metastasis, isoform E OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
7	AFDB:A0A0B4JCZ8	0.329	0.126	6.240E-26	2028	0.299	0.111	A0A0B4JCZ8.pdb.gz	A0A0B4JCZ8_DROME Missing-in-metastasis, isoform F OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
8	AFDB:E1JGY9	0.328	0.262	9.039E-26	950	0.299	0.238	E1JGY9.pdb.gz	E1JGY9_DROME Missing-in-metastasis, isoform D OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
9	AFDB:Q95Y95	0.238	0.275	4.414E-13	652	0.193	0.224	Q95Y95.pdb.gz	Q95Y95_CAEEL IMD domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_M04F3.5 PE=1 SV=2
10	AFDB:Q6AWD5	0.184	0.123	1.029E-8	1220	0.150	0.093	Q6AWD5.pdb.gz	Q6AWD5_DROME AT02057p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8176 PE=1 SV=1
11	PDB:6ikoA	0.156	0.269	2.316E-4	303	0.045	0.112	6ikoA.pdb.gz
12	PDB:3hajA	0.124	0.294	2.715E-4	286	0.032	0.084	3hajA.pdb.gz	Molecular mechanism of membrane constriction and tubulation mediated by the F-BAR protein Pacsin/Syndapin.
13	PDB:6q0xA	0.159	0.255	3.728E-2	373	0.030	0.062	6q0xA.pdb.gz
14	PDB:4o9yA	0.101	0.042	7.036E-2	2490	0.025	0.008	4o9yA.pdb.gz
15	PDB:6xz6A	0.150	0.377	7.419E-2	213	0.036	0.127	6xz6A.pdb.gz
16	PDB:4im0A	0.126	0.139	9.666E-2	619	0.049	0.060	4im0A.pdb.gz	Structure and ubiquitination-dependent activation of TANK-binding kinase 1.
17	PDB:7p54A	0.103	0.154	1.260E-1	397	0.053	0.101	7p54A.pdb.gz
18	PDB:4kxrB	0.114	0.365	1.328E-1	174	0.029	0.126	4kxrB.pdb.gz
19	PDB:6sueA	0.107	0.041	1.328E-1	2292	0.026	0.009	6sueA.pdb.gz
20	PDB:5lkiA	0.157	0.093	1.924E-1	1427	0.034	0.018	5lkiA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43312	0.0	1546	755	1.000	1.000	MTSS1_HUMAN Protein MTSS 1 OS=Homo sapiens OX=9606 GN=MTSS1 PE=1 SV=2
2	Q6P9S0	0.0	689	715	0.560	0.592	MTSS2_MOUSE Protein MTSS 2 OS=Mus musculus OX=10090 GN=Mtss2 PE=1 SV=1
3	Q8R1S4	0.0	1490	759	0.967	0.962	MTSS1_MOUSE Protein MTSS 1 OS=Mus musculus OX=10090 GN=Mtss1 PE=1 SV=1
4	A0A0B4KEU9	4.86e-93	310	804	0.215	0.201	A0A0B4KEU9_DROME Missing-in-metastasis, isoform K OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
5	A0A0B4JD47	6.91e-92	310	977	0.215	0.166	A0A0B4JD47_DROME Missing-in-metastasis, isoform E OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
6	A0A0B4K822	6.84e-91	310	1136	0.215	0.143	A0A0B4K822_DROME Missing-in-metastasis, isoform H OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
7	A0A0B4KEK0	1.91e-90	311	1362	0.215	0.119	A0A0B4KEK0_DROME Missing-in-metastasis, isoform N OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
8	A0A0B4KED3	3.92e-90	310	1299	0.215	0.125	A0A0B4KED3_DROME Missing-in-metastasis, isoform M OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
9	A0A0B4K7T1	4.43e-90	312	1868	0.215	0.087	A0A0B4K7T1_DROME Missing-in-metastasis, isoform J OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
10	A0A0B4KEE8	6.05e-90	311	1802	0.215	0.090	A0A0B4KEE8_DROME Missing-in-metastasis, isoform L OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
11	A0A0B4K7H4	6.88e-90	311	1934	0.215	0.084	A0A0B4K7H4_DROME Missing-in-metastasis, isoform I OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
12	E1JGY9	2.02e-89	303	950	0.196	0.156	E1JGY9_DROME Missing-in-metastasis, isoform D OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
13	A0A0B4JCZ8	1.25e-87	305	2028	0.196	0.073	A0A0B4JCZ8_DROME Missing-in-metastasis, isoform F OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
14	A0A0B4JCQ4	1.51e-87	305	2009	0.196	0.074	A0A0B4JCQ4_DROME Missing-in-metastasis, isoform G OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
15	A1Z6S0	1.92e-87	304	2027	0.196	0.073	A1Z6S0_DROME Missing-in-metastasis, isoform C OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=2
16	A8DY50	2.18e-87	304	1654	0.196	0.089	A8DY50_DROME Missing-in-metastasis, isoform B OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
17	Q765P7	1.02e-73	256	747	0.234	0.237	MTSS2_HUMAN Protein MTSS 2 OS=Homo sapiens OX=9606 GN=MTSS2 PE=1 SV=1
18	Q95Y95	1.03e-32	137	652	0.103	0.120	Q95Y95_CAEEL IMD domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_M04F3.5 PE=1 SV=2
19	Q6GMN2	3.35e-11	68.9	535	0.075	0.107	BAIP2_RAT Brain-specific angiogenesis inhibitor 1-associated protein 2 OS=Rattus norvegicus OX=10116 GN=Baiap2 PE=1 SV=1
20	Q60437	1.82e-10	66.6	521	0.074	0.107	BAIP2_CRIGR Brain-specific angiogenesis inhibitor 1-associated protein 2 OS=Cricetulus griseus OX=10029 GN=BAIAP2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07902 Gp58	1.4e+02	12.1	gp58-like protein
2	PF08397 IMD	4.4e-102	351.7	IRSp53/MIM homology domain
3	PF02205 WH2	0.00073	30.5	WH2 motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000006681

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000021050	0.768	GLI family zinc finger 1
2	61853.ENSNLEP00000001150	0.744	GLI family zinc finger 2
3	61853.ENSNLEP00000019838	0.701	V-akt murine thymoma viral oncogene homolog 1
4	61853.ENSNLEP00000009641	0.691	Kelch-like family member 22
5	61853.ENSNLEP00000012879	0.640	Cortactin
6	61853.ENSNLEP00000017442	0.630	Actin, alpha 1, skeletal muscle
7	61853.ENSNLEP00000001528	0.627	Secreted LY6/PLAUR domain containing 1
8	61853.ENSNLEP00000018430	0.572	SUFU negative regulator of hedgehog signaling
9	61853.ENSNLEP00000006643	0.559	NADH:ubiquinone oxidoreductase subunit B9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	0.997	identical protein binding
GO:0008092	0.995	cytoskeletal protein binding
GO:0003779	0.994	actin binding
GO:0051015	0.921	actin filament binding
GO:0005543	0.610	phospholipid binding
GO:0019904	0.422	protein domain specific binding
GO:0003785	0.368	actin monomer binding
GO:0017124	0.315	SH3 domain binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0050794	0.985	regulation of cellular process
GO:0050896	0.983	response to stimulus
GO:0071840	0.968	cellular component organization or biogenesis
GO:0016043	0.956	cellular component organization
GO:0051716	0.944	cellular response to stimulus
GO:0007165	0.901	signal transduction
GO:0006996	0.738	organelle organization
GO:0030029	0.730	actin filament-based process
GO:0030036	0.688	actin cytoskeleton organization
GO:0032502	0.660	developmental process
GO:0032501	0.630	multicellular organismal process
GO:0048518	0.621	positive regulation of biological process
GO:0048519	0.598	negative regulation of biological process
GO:0048856	0.592	anatomical structure development
GO:0051128	0.544	regulation of cellular component organization
GO:0048523	0.499	negative regulation of cellular process
GO:0048522	0.445	positive regulation of cellular process
GO:0030154	0.356	cell differentiation
GO:0007166	0.324	cell surface receptor signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0016020	0.996	membrane
GO:0005886	0.994	plasma membrane
GO:0043232	0.992	intracellular non-membrane-bounded organelle
GO:0005856	0.981	cytoskeleton
GO:0005829	0.974	cytosol
GO:0015629	0.964	actin cytoskeleton
GO:0031982	0.911	vesicle
GO:0120025	0.701	plasma membrane bounded cell projection
GO:0005634	0.692	nucleus
GO:0005576	0.569	extracellular region
GO:0031410	0.547	cytoplasmic vesicle
GO:0012505	0.532	endomembrane system
GO:0030054	0.530	cell junction
GO:0070161	0.506	anchoring junction
GO:0043230	0.455	extracellular organelle
GO:0065010	0.437	extracellular membrane-bounded organelle
GO:0005911	0.370	cell-cell junction
GO:0031252	0.368	cell leading edge
GO:0070013	0.351	intracellular organelle lumen
GO:0031981	0.339	nuclear lumen
GO:0030139	0.336	endocytic vesicle
GO:0070062	0.331	extracellular exosome
GO:0005654	0.312	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]