StarFunc result for job id O43314

User Input

>input (1243 residues)
MSEAPRFFVGPEDTEINPGNYRHFFHHADEDDEEEDDSPPERQIVVGICSMAKKSKSKPM
KEILERISLFKYITVVVFEEEVILNEPVENWPLCDCLISFHSKGFPLDKAVAYAKLRNPF
VINDLNMQYLIQDRREVYSILQAEGILLPRYAILNRDPNNPKECNLIEGEDHVEVNGEVF
QKPFVEKPVSAEDHNVYIYYPTSAGGGSQRLFRKIGSRSSVYSPESNVRKTGSYIYEEFM
PTDGTDVKVYTVGPDYAHAEARKSPALDGKVERDSEGKEVRYPVILNAREKLIAWKVCLA
FKQTVCGFDLLRANGQSYVCDVNGFSFVKNSMKYYDDCAKILGNIVMRELAPQFHIPWSI
PLEAEDIPIVPTTSGTMMELRCVIAVIRHGDRTPKQKMKMEVRHQKFFDLFEKCDGYKSG
KLKLKKPKQLQEVLDIARQLLMELGQNNDSEIEENKPKLEQLKTVLEMYGHFSGINRKVQ
LTYLPHGCPKTSSEEEDSRREEPSLLLVLKWGGELTPAGRVQAEELGRAFRCMYPGGQGD
YAGFPGCGLLRLHSTYRHDLKIYASDEGRVQMTAAAFAKGLLALEGELTPILVQMVKSAN
MNGLLDSDSDSLSSCQQRVKARLHEILQKDRDFTAEDYEKLTPSGSISLIKSMHLIKNPV
KTCDKVYSLIQSLTSQIRHRMEDPKSSDIQLYHSETLELMLRRWSKLEKDFKTKNGRYDI
SKIPDIYDCIKYDVQHNGSLKLENTMELYRLSKALADIVIPQEYGITKAEKLEIAKGYCT
PLVRKIRSDLQRTQDDDTVNKLHPVYSRGVLSPERHVRTRLYFTSESHVHSLLSILRYGA
LCNESKDEQWKRAMDYLNVVNELNYMTQIVIMLYEDPNKDLSSEERFHVELHFSPGAKGC
EEDKNLPSGYGYRPASRENEGRRPFKIDNDDEPHTSKRDEVDRAVILFKPMVSEPIHIHR
KSPLPRSRKTATNDEESPLSVSSPEGTGTWLHYTSGVGTGRRRRRSGEQITSSPVSPKSL
AFTSSIFGSWQQVVSENANYLRTPRTLVEQKQNPTVGSHCAGLFSTSVLGGSSSAPNLQD
YARTHRKKLTSSGCIDDATRGSAVKRFSISFARHPTNGFELYSMVPSICPLETLHNALSL
KQVDEFLASIASPSSDVPRKTAEISSTALRSSPIMRKKVSLNTYTPAKILPTPPATLKST
KASSKPATSGPSSAVVPNTSSRKKNITSKTETHEHKKNTGKKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43314	1.000	1.000	0.000	1243	1.000	1.000	O43314.pdb.gz	VIP2_HUMAN Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2 OS=Homo sapiens OX=9606 GN=PPIP5K2 PE=1 SV=3
2	AFDB:Q6ZQB6	0.765	0.840	0.000	1129	0.859	0.946	Q6ZQB6.pdb.gz	VIP2_MOUSE Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2 OS=Mus musculus OX=10090 GN=Ppip5k2 PE=1 SV=3
3	AFDB:F4J8C7	0.597	0.697	1.099E-87	1056	0.355	0.418	F4J8C7.pdb.gz	F4J8C7_ARATH Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase OS=Arabidopsis thaliana OX=3702 GN=ATVIP1 PE=1 SV=1
4	PDB:4iwxA	0.181	0.679	1.520E-10	294	0.043	0.184	4iwxA.pdb.gz	Structure and function of Escherichia coli RimK, an ATP-grasp fold, l-glutamyl ligase enzyme.
5	PDB:3vpbB	0.163	0.608	9.813E-10	282	0.036	0.160	3vpbB.pdb.gz	Lysine and arginine biosyntheses mediated by a common carrier protein in Sulfolobus
6	PDB:7tn8A	0.179	0.695	7.370E-9	281	0.043	0.192	7tn8A.pdb.gz	Structural and catalytic analyses of the InsP 6 kinase activities of higher plant ITPKs.
7	PDB:4fu0A	0.168	0.510	7.491E-8	343	0.041	0.149	4fu0A.pdb.gz	Structural and functional characterization of VanG D-Ala:D-Ser ligase associated with vancomycin resistance in Enterococcus faecalis
8	PDB:1e4eA	0.168	0.501	8.714E-8	341	0.043	0.155	1e4eA.pdb.gz	The molecular basis of vancomycin resistance in clinically relevant Enterococci: crystal structure of D-alanyl-D-lactate ligase (VanA).
9	PDB:3lwbA	0.159	0.513	5.087E-7	323	0.037	0.142	3lwbA.pdb.gz
10	PDB:6jilB	0.168	0.603	5.917E-7	298	0.037	0.154	6jilB.pdb.gz	Cyclization mechanism catalyzed by an ATP-grasp enzyme essential for d-cycloserine biosynthesis.
11	PDB:1nt4A	0.171	0.472	8.421E-7	391	0.054	0.171	1nt4A.pdb.gz	Functional insights revealed by the crystal structures of Escherichia coli glucose-1-phosphatase.
12	PDB:4c5aA	0.176	0.580	1.030E-6	306	0.035	0.141	4c5aA.pdb.gz	Inhibition of D-Ala:D-Ala ligase through a phosphorylated form of the antibiotic D-cycloserine.
13	PDB:3lwbB	0.171	0.599	1.705E-6	298	0.037	0.154	3lwbB.pdb.gz
14	AFDB:Q96QP1	0.060	0.060	8.537E-1	1244	0.095	0.095	Q96QP1.pdb.gz	ALPK1_HUMAN Alpha-protein kinase 1 OS=Homo sapiens OX=9606 GN=ALPK1 PE=1 SV=3
15	AFDB:D3IUT5	0.055	0.045	8.978E-1	1985	0.130	0.082	D3IUT5.pdb.gz	TICRR_XENLA Treslin OS=Xenopus laevis OX=8355 GN=ticrr PE=1 SV=1
16	AFDB:H8ESG1	0.045	0.039	1.044	1494	0.072	0.060	H8ESG1.pdb.gz	H8ESG1_CAEEL BRO1 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ego-2 PE=1 SV=1
17	AFDB:Q6PR54	0.053	0.036	1.044	2419	0.080	0.041	Q6PR54.pdb.gz	RIF1_MOUSE Telomere-associated protein RIF1 OS=Mus musculus OX=10090 GN=Rif1 PE=1 SV=2
18	AFDB:A0A0G2JZW4	0.049	0.035	1.155	2308	0.100	0.054	A0A0G2JZW4.pdb.gz	A0A0G2JZW4_RAT APC regulator of WNT signaling pathway 2 OS=Rattus norvegicus OX=10116 GN=Apc2 PE=3 SV=2
19	AFDB:E7F1U4	0.066	0.057	1.344	1507	0.099	0.082	E7F1U4.pdb.gz	E7F1U4_DANRE Ras/Rap GTPase-activating protein SynGAP1b OS=Danio rerio OX=7955 GN=si:dkey-246f6.1 PE=1 SV=4
20	AFDB:Q8T498	0.061	0.053	1.729	1580	0.084	0.066	Q8T498.pdb.gz	GAP2_DROME Ras GTPase-activating protein raskol OS=Drosophila melanogaster OX=7227 GN=raskol PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B7WPL9	0.0	1635	1429	0.661	0.575	B7WPL9_HUMAN Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase OS=Homo sapiens OX=9606 GN=PPIP5K1 PE=1 SV=1
2	F4J8C6	0.0	704	1050	0.348	0.412	VIP1L_ARATH Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase VIP1 OS=Arabidopsis thaliana OX=3702 GN=VIP1 PE=1 SV=1
3	F4J8C7	0.0	706	1056	0.348	0.410	F4J8C7_ARATH Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase OS=Arabidopsis thaliana OX=3702 GN=ATVIP1 PE=1 SV=1
4	F8W9A8	0.0	1583	1409	0.646	0.570	F8W9A8_HUMAN Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase OS=Homo sapiens OX=9606 GN=PPIP5K1 PE=1 SV=1
5	O43314	0.0	2583	1243	1.000	1.000	VIP2_HUMAN Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2 OS=Homo sapiens OX=9606 GN=PPIP5K2 PE=1 SV=3
6	P0C644	0.0	1609	1434	0.661	0.573	VIP1_RAT Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1 OS=Rattus norvegicus OX=10116 GN=Ppip5k1 PE=1 SV=1
7	P91309	0.0	1007	1323	0.415	0.390	VIP1_CAEEL Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase OS=Caenorhabditis elegans OX=6239 GN=F46F11.1 PE=3 SV=3
8	Q6PFW1	0.0	1628	1433	0.661	0.574	VIP1_HUMAN Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1 OS=Homo sapiens OX=9606 GN=PPIP5K1 PE=1 SV=1
9	Q6ZQB6	0.0	1992	1129	0.763	0.840	VIP2_MOUSE Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2 OS=Mus musculus OX=10090 GN=Ppip5k2 PE=1 SV=3
10	Q84WW3	0.0	748	1049	0.353	0.418	VIP2L_ARATH Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase VIP2 OS=Arabidopsis thaliana OX=3702 GN=VIP2 PE=1 SV=1
11	O74429	1.07e-137	444	920	0.261	0.352	VIP1_SCHPO Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=asp1 PE=1 SV=1
12	Q06685	9.66e-113	382	1146	0.212	0.230	VIP1_YEAST Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VIP1 PE=1 SV=1
13	Q54PE2	3.75e-77	265	484	0.115	0.295	Q54PE2_DICDI Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0284617 PE=3 SV=1
14	A0A1D8PMU9	2.72e-49	190	735	0.133	0.224	A0A1D8PMU9_CANAL Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=VIP1 PE=3 SV=1
15	Q9Y5A9	0.11	39.3	579	0.019	0.041	YTHD2_HUMAN YTH domain-containing family protein 2 OS=Homo sapiens OX=9606 GN=YTHDF2 PE=1 SV=2
16	Q91YT7	0.62	36.6	579	0.019	0.040	YTHD2_MOUSE YTH domain-containing family protein 2 OS=Mus musculus OX=10090 GN=Ythdf2 PE=1 SV=1
17	O44952	1.5	35.4	971	0.035	0.044	LONM_CAEEL Lon protease homolog, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=lonp-1 PE=3 SV=1
18	Q9SJM0	2.2	35.0	1904	0.026	0.017	CALSA_ARATH Callose synthase 10 OS=Arabidopsis thaliana OX=3702 GN=CALS10 PE=2 SV=5
19	Q8MYX3	2.8	34.3	391	0.014	0.046	Q8MYX3_DROME RE59988p OS=Drosophila melanogaster OX=7227 GN=Doc1 PE=2 SV=1
20	Q9U8L5	2.9	34.3	391	0.014	0.046	Q9U8L5_DROME Dorsocross1, isoform A OS=Drosophila melanogaster OX=7227 GN=Doc1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07011 Elf4	6.4e+02	11.7	Early Flowering 4 domain
2	PF00328 His_Phos_2	1.5e-135	464.1	Histidine phosphatase superfamily (branch 2)
3	PF18086 PPIP5K2_N	1.3e-38	142.3	Diphosphoinositol pentakisphosphate kinase 2 N-terminal domain
4	PF08443 RimK	7.3	17.7	RimK-like ATP-grasp domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9544.ENSMMUP00000010237

Rank	PPI partner	STRING score	Description
1	9544.ENSMMUP00000019153	0.994	Kinase
2	9544.ENSMMUP00000006175	0.990	Inositol-pentakisphosphate 2-kinase
3	9544.ENSMMUP00000032974	0.982	Uncharacterized protein
4	9544.ENSMMUP00000028621	0.951	Kinase
5	9544.ENSMMUP00000019326	0.941	Kinase
6	9544.ENSMMUP00000010334	0.845	Diphosphoinositol pentakisphosphate kinase 1
7	9544.ENSMMUP00000026061	0.653	Kinase
8	9544.ENSMMUP00000012577	0.623	Vasoactive intestinal peptide receptor 2
9	9544.ENSMMUP00000013989	0.620	Uncharacterized protein
10	9544.ENSMMUP00000031039	0.553	ATP binding cassette subfamily C member 8
11	9544.ENSMMUP00000026113	0.539	5'-AMP-activated protein kinase subunit beta-1
12	9544.ENSMMUP00000014520	0.515	EGF domain specific O-linked N-acetylglucosamine transferase
13	9544.ENSMMUP00000036544	0.507	Translation initiation factor IF-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0033857	1.000	diphosphoinositol-pentakisphosphate kinase activity
GO:0000828	1.000	inositol hexakisphosphate kinase activity
GO:0000829	0.990	inositol heptakisphosphate kinase activity
GO:0005488	0.980	binding
GO:0005515	0.955	protein binding
GO:0097159	0.838	organic cyclic compound binding
GO:1901363	0.837	heterocyclic compound binding
GO:0036094	0.640	small molecule binding
GO:0043167	0.633	ion binding
GO:0000166	0.611	nucleotide binding
GO:0032555	0.596	purine ribonucleotide binding
GO:0043168	0.592	anion binding
GO:0005524	0.572	ATP binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0008152	0.999	metabolic process
GO:0071704	0.989	organic substance metabolic process
GO:0044237	0.960	cellular metabolic process
GO:0006796	0.918	phosphate-containing compound metabolic process
GO:0019637	0.893	organophosphate metabolic process
GO:0044281	0.833	small molecule metabolic process
GO:1901615	0.797	organic hydroxy compound metabolic process
GO:0006066	0.763	alcohol metabolic process
GO:0043647	0.740	inositol phosphate metabolic process
GO:0044238	0.510	primary metabolic process
GO:0065007	0.353	biological regulation
GO:0050794	0.318	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0016020	0.638	membrane
GO:0005886	0.616	plasma membrane
GO:0043227	0.438	membrane-bounded organelle
GO:0043231	0.407	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.4.-	1.000	Phosphotransferases with a phosphate group as acceptor.
EC:2.7.4.24	1.000	diphosphoinositol-pentakisphosphate 1-kinase.

[back to server]