StarFunc result for job id O43318

User Input

>input (606 residues)
MSTASAASSSSSSSAGEMIEAPSQVLNFEEIDYKEIEVEEVVGRGAFGVVCKAKWRAKDV
AIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAE
PLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTAC
DIQTHMTNNKGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIM
WAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQY
PCQYSDEGQSNSATSTGSFMDIASTNTSNKSDTNMEQVPATNDTIKRLESKLLKNQAKQQ
SESGRLSLGASRGSSVESLPPTSEGKRMSADMSEIEARIAATTAYSKPKRGHRKTASFGN
ILDVPEIVISGNGQPRRRSIQDLTVTGTEPGQVSSRSSSPSVRMITTSGPTSEKPTRSHP
WTPDDSTDTNGSDNSIPMAYLTLDHQLQPLAPCPNSKESMAVFEQHCKMAQEYMKVQTEI
ALLLQRKQELVAELDQDEKDQQNTSRLVQEHKKLLDENKSLSTYYQQCKKQLEVIRSQQQ
KRQGTS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43318	1.000	1.000	1.246E-90	606	1.000	1.000	O43318.pdb.gz	M3K7_HUMAN Mitogen-activated protein kinase kinase kinase 7 OS=Homo sapiens OX=9606 GN=MAP3K7 PE=1 SV=1
2	AFDB:Q62073	0.705	0.737	5.738E-81	579	0.947	0.991	Q62073.pdb.gz	M3K7_MOUSE Mitogen-activated protein kinase kinase kinase 7 OS=Mus musculus OX=10090 GN=Map3k7 PE=1 SV=1
3	AFDB:O73613	0.515	0.506	1.129E-75	616	0.896	0.881	O73613.pdb.gz	O73613_XENLA Mitogen-activated protein kinase kinase kinase 7 OS=Xenopus laevis OX=8355 GN=map3k7.L PE=2 SV=1
4	AFDB:A0A1D5NUC4	0.479	0.453	1.749E-72	643	0.908	0.855	A0A1D5NUC4.pdb.gz
5	AFDB:A0A0R4IVJ5	0.661	0.691	5.134E-69	578	0.756	0.792	A0A0R4IVJ5.pdb.gz
6	AFDB:Q5RIS5	0.485	0.532	3.175E-65	551	0.729	0.802	Q5RIS5.pdb.gz
7	AFDB:Q9V3Q6	0.540	0.486	1.433E-38	678	0.351	0.314	Q9V3Q6.pdb.gz	M3K7_DROME Mitogen-activated protein kinase kinase kinase 7 OS=Drosophila melanogaster OX=7227 GN=Tak1 PE=2 SV=1
8	AFDB:Q7T2V3	0.405	0.249	1.783E-19	1005	0.216	0.130	Q7T2V3.pdb.gz	M3K10_XENLA Mitogen-activated protein kinase kinase kinase 10 OS=Xenopus laevis OX=8355 GN=map3k10 PE=1 SV=1
9	AFDB:F4HPR9	0.368	0.326	4.347E-18	688	0.206	0.182	F4HPR9.pdb.gz	F4HPR9_ARATH Protein kinase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=ATMAP4K PE=1 SV=1
10	AFDB:Q60700	0.371	0.256	5.673E-18	888	0.208	0.142	Q60700.pdb.gz	M3K12_MOUSE Mitogen-activated protein kinase kinase kinase 12 OS=Mus musculus OX=10090 GN=Map3k12 PE=1 SV=1
11	PDB:2h8hA	0.387	0.518	1.774E-17	445	0.134	0.182	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
12	PDB:1k9aB	0.385	0.522	4.101E-16	441	0.116	0.159	1k9aB.pdb.gz
13	PDB:4k2rA	0.366	0.401	6.278E-16	551	0.124	0.136	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
14	PDB:4btfA	0.355	0.503	7.768E-16	413	0.102	0.150	4btfA.pdb.gz
15	PDB:6s73A	0.379	0.815	1.552E-15	269	0.104	0.234	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
16	PDB:6uanB	0.344	0.767	1.820E-15	261	0.139	0.322	6uanB.pdb.gz
17	PDB:7mfdA	0.369	0.532	1.920E-15	410	0.157	0.232	7mfdA.pdb.gz	Structural insights into the BRAF monomer-to-dimer transition mediated by RAS binding.
18	PDB:4eomC	0.358	0.749	2.506E-15	276	0.130	0.286	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
19	PDB:6lk5A	0.376	0.821	3.637E-15	265	0.116	0.264	6lk5A.pdb.gz
20	PDB:5u6yA	0.364	0.472	4.045E-15	459	0.129	0.170	5u6yA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43318	0.0	1268	606	1.000	1.000	M3K7_HUMAN Mitogen-activated protein kinase kinase kinase 7 OS=Homo sapiens OX=9606 GN=MAP3K7 PE=1 SV=1
2	O73613	0.0	1088	616	0.896	0.881	O73613_XENLA Mitogen-activated protein kinase kinase kinase 7 OS=Xenopus laevis OX=8355 GN=map3k7.L PE=2 SV=1
3	P0C8E4	0.0	1255	606	0.990	0.990	M3K7_RAT Mitogen-activated protein kinase kinase kinase 7 OS=Rattus norvegicus OX=10116 GN=Map3k7 PE=1 SV=1
4	Q503G7	0.0	855	544	0.729	0.812	Q503G7_DANRE Mitogen-activated protein kinase kinase kinase 7 OS=Danio rerio OX=7955 GN=zgc:110612 PE=1 SV=1
5	Q62073	0.0	1189	579	0.949	0.993	M3K7_MOUSE Mitogen-activated protein kinase kinase kinase 7 OS=Mus musculus OX=10090 GN=Map3k7 PE=1 SV=1
6	Q9V3Q6	1.28e-104	332	678	0.254	0.227	M3K7_DROME Mitogen-activated protein kinase kinase kinase 7 OS=Drosophila melanogaster OX=7227 GN=Tak1 PE=2 SV=1
7	Q66L42	5.83e-51	191	940	0.173	0.112	M3K10_MOUSE Mitogen-activated protein kinase kinase kinase 10 OS=Mus musculus OX=10090 GN=Map3k10 PE=1 SV=2
8	D3ZG83	7.12e-51	191	940	0.173	0.112	M3K10_RAT Mitogen-activated protein kinase kinase kinase 10 OS=Rattus norvegicus OX=10116 GN=Map3k10 PE=1 SV=3
9	Q02779	8.34e-51	191	954	0.173	0.110	M3K10_HUMAN Mitogen-activated protein kinase kinase kinase 10 OS=Homo sapiens OX=9606 GN=MAP3K10 PE=1 SV=3
10	Q54TM7	5.03e-47	180	1288	0.168	0.079	DRKD_DICDI Probable serine/threonine-protein kinase drkD OS=Dictyostelium discoideum OX=44689 GN=drkD PE=2 SV=1
11	Q54I36	6.98e-47	180	1338	0.163	0.074	PYK3_DICDI Dual specificity protein kinase pyk3 OS=Dictyostelium discoideum OX=44689 GN=pyk3 PE=1 SV=1
12	Q9M085	1.23e-46	171	412	0.172	0.252	Q9M085_ARATH AT4G31170 protein OS=Arabidopsis thaliana OX=3702 GN=RAF28 PE=1 SV=1
13	D4Q8H0	2.78e-46	171	455	0.162	0.215	D4Q8H0_HUMAN Protein kinase OS=Homo sapiens OX=9606 GN=pk PE=1 SV=1
14	Q54TA1	3.04e-45	173	749	0.175	0.142	DRKC_DICDI Probable serine/threonine-protein kinase drkC OS=Dictyostelium discoideum OX=44689 GN=drkC PE=3 SV=1
15	P80192	8.12e-45	173	1104	0.182	0.100	M3K9_HUMAN Mitogen-activated protein kinase kinase kinase 9 OS=Homo sapiens OX=9606 GN=MAP3K9 PE=1 SV=3
16	Q9ESL4	9.76e-45	172	802	0.163	0.123	M3K20_MOUSE Mitogen-activated protein kinase kinase kinase 20 OS=Mus musculus OX=10090 GN=Map3k20 PE=1 SV=1
17	A0A0G2JUN9	1.69e-44	172	1078	0.175	0.098	A0A0G2JUN9_RAT Mitogen-activated protein kinase kinase kinase OS=Rattus norvegicus OX=10116 GN=Map3k9 PE=3 SV=2
18	F1LRA7	1.90e-44	172	1100	0.175	0.096	F1LRA7_RAT Mitogen-activated protein kinase kinase kinase OS=Rattus norvegicus OX=10116 GN=Map3k9 PE=3 SV=2
19	Q9NYL2	1.94e-44	171	800	0.163	0.124	M3K20_HUMAN Mitogen-activated protein kinase kinase kinase 20 OS=Homo sapiens OX=9606 GN=MAP3K20 PE=1 SV=3
20	Q7T2V3	2.26e-44	172	1005	0.163	0.099	M3K10_XENLA Mitogen-activated protein kinase kinase kinase 10 OS=Xenopus laevis OX=8355 GN=map3k10 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01636 APH	23	16.3	Phosphotransferase enzyme family
2	PF00069 Pkinase	5.2e-52	188.4	Protein kinase domain
3	PF07714 PK_Tyr_Ser-Thr	1.7e-56	203.0	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010356055.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010356705.1	0.999	Belongs to the TNF receptor-associated factor family.
2	61622.XP_010379330.1	0.999	TGF-beta-activated kinase 1 and MAP3K7-binding protein 2 isoform X1
3	61622.XP_010387580.1	0.999	TGF-beta-activated kinase 1 and MAP3K7-binding protein 1 isoform X1
4	61622.XP_010356465.1	0.996	TGF-beta-activated kinase 1 and MAP3K7-binding protein 3
5	61622.XP_010351423.1	0.994	Dual specificity mitogen-activated protein kinase kinase 6 isoform X1
6	61622.XP_010366341.1	0.990	Inhibitor of nuclear factor kappa B kinase subunit beta
7	61622.XP_010354387.1	0.989	Conserved helix-loop-helix ubiquitous kinase
8	61622.XP_010370606.1	0.989	Nemo like kinase
9	61622.XP_010370993.1	0.989	TNF receptor-associated factor 2 isoform X1
10	61622.XP_010360102.1	0.988	Receptor-interacting serine/threonine-protein kinase 1 isoform X1
11	61622.XP_010362411.1	0.988	Interleukin-1 receptor-associated kinase 1
12	61622.XP_010367530.1	0.988	Inhibitor of nuclear factor kappa B kinase subunit gamma
13	61622.XP_010383404.1	0.988	Dual specificity mitogen-activated protein kinase kinase 7
14	61622.XP_010380860.1	0.982	B-cell CLL/lymphoma 10
15	61622.XP_010382075.1	0.982	Belongs to the protein kinase superfamily.
16	61622.XP_010374431.1	0.971	Belongs to the protein kinase superfamily.
17	61622.XP_010380703.1	0.959	Interleukin-1 receptor-associated kinase 4
18	61622.XP_010353442.1	0.954	TNFRSF1A associated via death domain
19	61622.XP_010368913.1	0.954	Mitogen-activated protein kinase 10
20	61622.XP_010364975.1	0.953	Caspase recruitment domain-containing protein 11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004674	0.999	protein serine/threonine kinase activity
GO:0019899	0.959	enzyme binding
GO:0019901	0.817	protein kinase binding
GO:0005102	0.788	signaling receptor binding
GO:1990782	0.668	protein tyrosine kinase binding
GO:0030971	0.662	receptor tyrosine kinase binding
GO:0042802	0.648	identical protein binding
GO:0004709	0.605	MAP kinase kinase kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0007154	0.996	cell communication
GO:0051716	0.996	cellular response to stimulus
GO:0048583	0.994	regulation of response to stimulus
GO:0007165	0.994	signal transduction
GO:0023051	0.988	regulation of signaling
GO:0048518	0.985	positive regulation of biological process
GO:0048522	0.982	positive regulation of cellular process
GO:0010646	0.980	regulation of cell communication
GO:0000165	0.966	MAPK cascade
GO:0009966	0.963	regulation of signal transduction
GO:0048584	0.956	positive regulation of response to stimulus
GO:0071704	0.951	organic substance metabolic process
GO:0009967	0.922	positive regulation of signal transduction
GO:0044238	0.912	primary metabolic process
GO:0043123	0.875	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0019222	0.858	regulation of metabolic process
GO:0006807	0.836	nitrogen compound metabolic process
GO:0060255	0.783	regulation of macromolecule metabolic process
GO:0043170	0.782	macromolecule metabolic process
GO:0031323	0.752	regulation of cellular metabolic process
GO:0080090	0.751	regulation of primary metabolic process
GO:0051171	0.747	regulation of nitrogen compound metabolic process
GO:1901564	0.730	organonitrogen compound metabolic process
GO:0044237	0.722	cellular metabolic process
GO:0019538	0.706	protein metabolic process
GO:0036211	0.690	protein modification process
GO:0009893	0.636	positive regulation of metabolic process
GO:0016310	0.537	phosphorylation
GO:0032502	0.463	developmental process
GO:0006950	0.445	response to stress
GO:0006468	0.432	protein phosphorylation
GO:0010468	0.429	regulation of gene expression
GO:0032501	0.398	multicellular organismal process
GO:0010604	0.398	positive regulation of macromolecule metabolic process
GO:0007166	0.397	cell surface receptor signaling pathway
GO:0031325	0.372	positive regulation of cellular metabolic process
GO:0009889	0.370	regulation of biosynthetic process
GO:0048856	0.342	anatomical structure development
GO:0019219	0.325	regulation of nucleobase-containing compound metabolic process
GO:0051246	0.321	regulation of protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	1.000	organelle
GO:0005829	0.999	cytosol
GO:0043231	0.957	intracellular membrane-bounded organelle
GO:0070013	0.876	intracellular organelle lumen
GO:0016020	0.870	membrane
GO:0005634	0.797	nucleus
GO:0071944	0.748	cell periphery
GO:0032991	0.668	protein-containing complex
GO:0005886	0.584	plasma membrane
GO:0031981	0.367	nuclear lumen
GO:0005654	0.309	nucleoplasm
GO:0043232	0.306	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.999	Phosphotransferases with an alcohol group as acceptor.
EC:2.7.11.25	0.605	mitogen-activated protein kinase kinase kinase.

[back to server]