StarFunc result for job id O43320

User Input

>input (207 residues)
MAEVGGVFASLDWDLHGFSSSLGNVPLADSPGFLNERLGQIEGKLQRGSPTDFAHLKGIL
RRRQLYCRTGFHLEIFPNGTVHGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNER
GELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRH
QKFTHFLPRPVDPSKLPSMSRDLFHYR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43320	1.000	1.000	2.153E-40	207	1.000	1.000	O43320.pdb.gz	FGF16_HUMAN Fibroblast growth factor 16 OS=Homo sapiens OX=9606 GN=FGF16 PE=1 SV=1
2	AFDB:Q38PL0	0.792	0.788	2.042E-29	208	0.618	0.615	Q38PL0.pdb.gz	Q38PL0_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=dob PE=2 SV=1
3	AFDB:Q2HXK8	0.779	0.794	5.098E-29	203	0.787	0.803	Q2HXK8.pdb.gz	FGF16_DANRE Fibroblast growth factor 16 OS=Danio rerio OX=7955 GN=fgf16 PE=2 SV=1
4	AFDB:P31371	0.757	0.754	5.716E-29	208	0.691	0.688	P31371.pdb.gz	FGF9_HUMAN Fibroblast growth factor 9 OS=Homo sapiens OX=9606 GN=FGF9 PE=1 SV=3
5	AFDB:Q2LJ24	0.743	0.739	2.528E-28	208	0.647	0.644	Q2LJ24.pdb.gz	Q2LJ24_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=fgf20b PE=2 SV=1
6	AFDB:Q9EST9	0.752	0.734	3.178E-28	212	0.638	0.623	Q9EST9.pdb.gz	FGF20_RAT Fibroblast growth factor 20 OS=Rattus norvegicus OX=10116 GN=Fgf20 PE=2 SV=1
7	PDB:3f1rA	0.732	0.960	2.077E-25	157	0.560	0.739	3f1rA.pdb.gz	Homodimerization controls the fibroblast growth factor 9 subfamily's receptor binding and heparan sulfate-dependent diffusion in the extracellular matrix
8	AFDB:P11487	0.650	0.566	2.300E-18	239	0.377	0.326	P11487.pdb.gz	FGF3_HUMAN Fibroblast growth factor 3 OS=Homo sapiens OX=9606 GN=FGF3 PE=1 SV=1
9	AFDB:P48802	0.652	0.530	2.578E-18	256	0.372	0.301	P48802.pdb.gz	FGF3_DANRE Fibroblast growth factor 3 OS=Danio rerio OX=7955 GN=fgf3 PE=1 SV=1
10	AFDB:P05524	0.664	0.564	1.433E-17	245	0.333	0.282	P05524.pdb.gz	FGF3_MOUSE Fibroblast growth factor 3 OS=Mus musculus OX=10090 GN=Fgf3 PE=1 SV=3
11	AFDB:P48807	0.610	0.478	5.043E-17	266	0.377	0.293	P48807.pdb.gz	FGF5_RAT Fibroblast growth factor 5 OS=Rattus norvegicus OX=10116 GN=Fgf5 PE=2 SV=1
12	PDB:1ry7A	0.593	0.801	1.731E-13	151	0.266	0.364	1ry7A.pdb.gz
13	PDB:4jq0A	0.608	0.882	3.246E-13	141	0.227	0.333	4jq0A.pdb.gz	Structural analyses of Ca(2+)/CaM interaction with NaV channel C-termini reveal mechanisms of calcium-dependent regulation.
14	PDB:4qd2B	0.521	0.727	3.885E-6	143	0.072	0.105	4qd2B.pdb.gz	Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex.
15	PDB:6b0tA	0.495	0.223	2.831E-4	487	0.082	0.035	6b0tA.pdb.gz	Structural Insights into the Induced-fit Inhibition of Fascin by a Small-Molecule Inhibitor.
16	PDB:3malA	0.432	0.489	3.990E-4	181	0.097	0.110	3malA.pdb.gz
17	PDB:1hcdA	0.444	0.717	5.016E-4	118	0.087	0.153	1hcdA.pdb.gz
18	PDB:4qd2C	0.502	0.372	1.326E-3	286	0.072	0.052	4qd2C.pdb.gz	Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex.
19	PDB:7a5px	0.445	0.696	1.667E-3	125	0.111	0.184	7a5px.pdb.gz	Structural Insights into the Roles of Metazoan-Specific Splicing Factors in the Human Step 1 Spliceosome.
20	PDB:4a7zA	0.490	0.129	1.979E-3	881	0.053	0.012	4a7zA.pdb.gz	Crystal Structure of Bifunctional Aldos-2-Ulose Dehydratase/Isomerase from Phanerochaete Chrysosporium with the Reaction Intermediate Ascopyrone M.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43320	9.74e-155	428	207	1.000	1.000	FGF16_HUMAN Fibroblast growth factor 16 OS=Homo sapiens OX=9606 GN=FGF16 PE=1 SV=1
2	O54769	3.16e-152	422	207	0.986	0.986	FGF16_RAT Fibroblast growth factor 16 OS=Rattus norvegicus OX=10116 GN=Fgf16 PE=2 SV=1
3	Q2HXK8	1.24e-117	334	203	0.787	0.803	FGF16_DANRE Fibroblast growth factor 16 OS=Danio rerio OX=7955 GN=fgf16 PE=2 SV=1
4	P31371	1.40e-103	299	208	0.720	0.716	FGF9_HUMAN Fibroblast growth factor 9 OS=Homo sapiens OX=9606 GN=FGF9 PE=1 SV=3
5	P36364	1.42e-103	299	208	0.720	0.716	FGF9_RAT Fibroblast growth factor 9 OS=Rattus norvegicus OX=10116 GN=Fgf9 PE=2 SV=2
6	P54130	1.42e-103	299	208	0.720	0.716	FGF9_MOUSE Fibroblast growth factor 9 OS=Mus musculus OX=10090 GN=Fgf9 PE=2 SV=2
7	Q9ESL9	1.58e-94	276	211	0.652	0.640	FGF20_MOUSE Fibroblast growth factor 20 OS=Mus musculus OX=10090 GN=Fgf20 PE=2 SV=2
8	Q2LJ24	2.90e-93	273	208	0.652	0.649	Q2LJ24_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=fgf20b PE=2 SV=1
9	Q9EST9	6.33e-93	272	212	0.638	0.623	FGF20_RAT Fibroblast growth factor 20 OS=Rattus norvegicus OX=10116 GN=Fgf20 PE=2 SV=1
10	Q9NP95	1.86e-91	268	211	0.609	0.597	FGF20_HUMAN Fibroblast growth factor 20 OS=Homo sapiens OX=9606 GN=FGF20 PE=1 SV=1
11	Q38PL0	2.88e-91	268	208	0.623	0.620	Q38PL0_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=dob PE=2 SV=1
12	P11487	3.39e-37	131	239	0.324	0.280	FGF3_HUMAN Fibroblast growth factor 3 OS=Homo sapiens OX=9606 GN=FGF3 PE=1 SV=1
13	O15520	1.48e-36	129	208	0.290	0.288	FGF10_HUMAN Fibroblast growth factor 10 OS=Homo sapiens OX=9606 GN=FGF10 PE=1 SV=1
14	P70492	1.79e-36	129	215	0.290	0.279	FGF10_RAT Fibroblast growth factor 10 OS=Rattus norvegicus OX=10116 GN=Fgf10 PE=2 SV=1
15	Q9ESS2	2.29e-36	127	162	0.319	0.407	FGF22_MOUSE Fibroblast growth factor 22 OS=Mus musculus OX=10090 GN=Fgf22 PE=2 SV=1
16	O35565	7.65e-36	127	209	0.280	0.278	FGF10_MOUSE Fibroblast growth factor 10 OS=Mus musculus OX=10090 GN=Fgf10 PE=2 SV=1
17	O42407	2.38e-35	125	212	0.280	0.274	O42407_CHICK Fibroblast growth factor OS=Gallus gallus OX=9031 PE=2 SV=2
18	P05524	3.78e-35	126	245	0.314	0.265	FGF3_MOUSE Fibroblast growth factor 3 OS=Mus musculus OX=10090 GN=Fgf3 PE=1 SV=3
19	P48802	8.62e-35	125	256	0.304	0.246	FGF3_DANRE Fibroblast growth factor 3 OS=Danio rerio OX=7955 GN=fgf3 PE=1 SV=1
20	P21781	7.80e-34	121	194	0.280	0.299	FGF7_HUMAN Fibroblast growth factor 7 OS=Homo sapiens OX=9606 GN=FGF7 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00167 FGF	2.5e-44	161.7	Fibroblast growth factor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000001332

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000014960	0.947	Fibroblast growth factor receptor 1
2	61853.ENSNLEP00000020533	0.935	Fibroblast growth factor receptor 2
3	61853.ENSNLEP00000000072	0.933	Uncharacterized protein
4	61853.ENSNLEP00000015352	0.921	Fibroblast growth factor receptor 4
5	61853.ENSNLEP00000000457	0.862	Fms-related tyrosine kinase 3
6	61853.ENSNLEP00000010298	0.826	Kinase insert domain receptor (a type III receptor tyrosine kinase)
7	61853.ENSNLEP00000020085	0.819	Pro-epidermal growth factor
8	61853.ENSNLEP00000000655	0.815	Fms-related tyrosine kinase 1
9	61853.ENSNLEP00000010419	0.813	Receptor protein-tyrosine kinase
10	61853.ENSNLEP00000012499	0.790	Platelet-derived growth factor receptor beta
11	61853.ENSNLEP00000010174	0.788	KIT proto-oncogene receptor tyrosine kinase
12	61853.ENSNLEP00000003032	0.784	Fms-related tyrosine kinase 4
13	61853.ENSNLEP00000023996	0.776	Hepatocyte growth factor (hepapoietin A
14	61853.ENSNLEP00000019785	0.774	TEK tyrosine kinase, endothelial
15	61853.ENSNLEP00000001285	0.759	Receptor protein-tyrosine kinase
16	61853.ENSNLEP00000010109	0.751	HRas proto-oncogene, GTPase
17	61853.ENSNLEP00000004655	0.747	Fibroblast growth factor receptor substrate 2
18	61853.ENSNLEP00000014096	0.745	Receptor tyrosine kinase that transduces signals from the extracellular matrix into the cytoplasm by binding to hepatocyte growth factor/HGF ligand. Regulates many physiological processes including proliferation, scattering, morphogenesis and survival. Ligand binding at the cell surface induces autophosphorylation of MET on its intracellular domain that provides docking sites for downstream signaling molecules. Following activation by ligand, interacts with the PI3-kinase subunit PIK3R1, PLCG1, SRC, GRB2, STAT3 or the adapter GAB1. Recruitment of these downstream effectors by MET leads [...]
19	61853.ENSNLEP00000010082	0.742	Platelet-derived growth factor receptor alpha
20	61853.ENSNLEP00000008780	0.730	Receptor protein-tyrosine kinase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008083	0.999	growth factor activity
GO:0070851	0.908	growth factor receptor binding
GO:0005104	0.849	fibroblast growth factor receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0007165	0.986	signal transduction
GO:0048518	0.985	positive regulation of biological process
GO:0007166	0.969	cell surface receptor signaling pathway
GO:0032502	0.967	developmental process
GO:0048856	0.955	anatomical structure development
GO:0070848	0.952	response to growth factor
GO:0048522	0.945	positive regulation of cellular process
GO:0007167	0.941	enzyme-linked receptor protein signaling pathway
GO:0071774	0.930	response to fibroblast growth factor
GO:0007169	0.929	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0032501	0.913	multicellular organismal process
GO:0071363	0.905	cellular response to growth factor stimulus
GO:0042127	0.897	regulation of cell population proliferation
GO:0048583	0.863	regulation of response to stimulus
GO:0044344	0.852	cellular response to fibroblast growth factor stimulus
GO:0008543	0.797	fibroblast growth factor receptor signaling pathway
GO:0019222	0.776	regulation of metabolic process
GO:0008284	0.757	positive regulation of cell population proliferation
GO:0048584	0.743	positive regulation of response to stimulus
GO:0007275	0.739	multicellular organism development
GO:0009893	0.702	positive regulation of metabolic process
GO:0060255	0.674	regulation of macromolecule metabolic process
GO:0048513	0.653	animal organ development
GO:0048731	0.647	system development
GO:0040012	0.638	regulation of locomotion
GO:0010646	0.625	regulation of cell communication
GO:0023051	0.624	regulation of signaling
GO:0009966	0.608	regulation of signal transduction
GO:0040017	0.592	positive regulation of locomotion
GO:0010604	0.552	positive regulation of macromolecule metabolic process
GO:0048519	0.540	negative regulation of biological process
GO:0030335	0.521	positive regulation of cell migration
GO:0023056	0.511	positive regulation of signaling
GO:0010647	0.507	positive regulation of cell communication
GO:0009967	0.494	positive regulation of signal transduction
GO:0051239	0.474	regulation of multicellular organismal process
GO:0031323	0.437	regulation of cellular metabolic process
GO:0048523	0.421	negative regulation of cellular process
GO:0080090	0.413	regulation of primary metabolic process
GO:0030154	0.396	cell differentiation
GO:0009653	0.389	anatomical structure morphogenesis
GO:0050793	0.374	regulation of developmental process
GO:0051171	0.371	regulation of nitrogen compound metabolic process
GO:0031325	0.370	positive regulation of cellular metabolic process
GO:0051173	0.351	positive regulation of nitrogen compound metabolic process
GO:0010468	0.318	regulation of gene expression
GO:0043408	0.317	regulation of MAPK cascade

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0005615	0.982	extracellular space
GO:0071944	0.954	cell periphery
GO:0005622	0.897	intracellular anatomical structure
GO:0005737	0.776	cytoplasm
GO:0005886	0.758	plasma membrane
GO:0043226	0.307	organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]