StarFunc result for job id O43325

User Input

>input (122 residues)
MTTATRQEVLGLYRSIFRLARKWQATSGQMEDTIKEKQYILNEARTLFRKNKNLTDTDLI
KQCIDECTARIEIGLHYKIPYPRPIHLPPMGLTPLRGRGLRSQEKLRKLSKPVYLRSHDE
VS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R3C2	0.955	0.955	1.435E-17	122	1.000	1.000	A0A024R3C2.pdb.gz
2	AFDB:Q9CQB7	0.942	0.942	1.819E-15	122	0.877	0.877	Q9CQB7.pdb.gz	LYRM1_MOUSE LYR motif-containing protein 1 OS=Mus musculus OX=10090 GN=Lyrm1 PE=1 SV=1
3	PDB:6uxeB	0.448	0.630	1.195E-2	85	0.164	0.235	6uxeB.pdb.gz	The essential function of ISCU2 and its conserved N-terminus in Fe/S cluster biogenesis
4	AFDB:Q9HD34	0.464	0.614	1.402E-2	91	0.189	0.253	Q9HD34.pdb.gz	LYRM4_HUMAN LYR motif-containing protein 4 OS=Homo sapiens OX=9606 GN=LYRM4 PE=1 SV=1
5	AFDB:Q0VCG0	0.465	0.615	2.461E-2	91	0.172	0.231	Q0VCG0.pdb.gz	LYRM4_BOVIN LYR motif-containing protein 4 OS=Bos taurus OX=9913 GN=LYRM4 PE=3 SV=1
6	AFDB:Q6Q560	0.453	0.581	2.755E-2	94	0.164	0.213	Q6Q560.pdb.gz	ISD11_YEAST Protein ISD11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ISD11 PE=1 SV=1
7	AFDB:Q8R033	0.468	0.636	3.651E-2	88	0.180	0.250	Q8R033.pdb.gz	LYRM2_MOUSE LYR motif-containing protein 2 OS=Mus musculus OX=10090 GN=Lyrm2 PE=3 SV=1
8	AFDB:Q9NU23	0.499	0.677	5.414E-2	88	0.180	0.250	Q9NU23.pdb.gz	LYRM2_HUMAN LYR motif-containing protein 2 OS=Homo sapiens OX=9606 GN=LYRM2 PE=1 SV=1
9	AFDB:O46098	0.443	0.575	6.060E-2	92	0.156	0.207	O46098.pdb.gz	BCN92_DROME Protein bcn92 OS=Drosophila melanogaster OX=7227 GN=bcn92 PE=1 SV=1
10	AFDB:Q63Z96	0.488	0.384	7.175E-2	157	0.180	0.140	Q63Z96.pdb.gz	Q63Z96_ARATH At1g76060 OS=Arabidopsis thaliana OX=3702 GN=EMB1793 PE=1 SV=1
11	AFDB:Q8L9E3	0.426	0.584	2.091E-1	87	0.156	0.218	Q8L9E3.pdb.gz	Q8L9E3_ARATH At5g61220 OS=Arabidopsis thaliana OX=3702 GN=MAF19.16 PE=1 SV=1
12	PDB:7qsdn	0.405	0.301	6.507E-1	172	0.205	0.145	7qsdn.pdb.gz	Structural basis of mammalian respiratory complex I inhibition by medicinal biguanides.
13	PDB:7qsmW	0.447	0.469	6.884E-1	116	0.123	0.129	7qsmW.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
14	PDB:7b93n	0.411	0.294	7.705E-1	178	0.197	0.135	7b93n.pdb.gz	Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.
15	PDB:6jcxF	0.217	0.162	8.623E-1	186	0.139	0.091	6jcxF.pdb.gz	Structures and mechanism of transcription initiation by bacterial ECF factors.
16	PDB:5xtbH	0.405	0.435	1.279	112	0.074	0.080	5xtbH.pdb.gz	Architecture of Human Mitochondrial Respiratory Megacomplex I2III2IV2.
17	PDB:7aqwn	0.416	0.457	1.695	109	0.172	0.193	7aqwn.pdb.gz	A ferredoxin bridge connects the two arms of plant mitochondrial complex I.
18	PDB:7b93V	0.320	0.335	2.513	115	0.107	0.113	7b93V.pdb.gz	Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.
19	PDB:5w7gA	0.248	0.235	2.813	131	0.139	0.130	5w7gA.pdb.gz	Model for a novel membrane envelope in a filamentous hyperthermophilic virus.
20	PDB:6kopF	0.216	0.175	3.524	159	0.123	0.094	6kopF.pdb.gz	RNA extension drives a stepwise displacement of an initiation-factor structural module in initial transcription.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43325	3.88e-88	253	122	1.000	1.000	LYRM1_HUMAN LYR motif-containing protein 1 OS=Homo sapiens OX=9606 GN=LYRM1 PE=2 SV=1
2	Q9CQB7	2.24e-76	223	122	0.877	0.877	LYRM1_MOUSE LYR motif-containing protein 1 OS=Mus musculus OX=10090 GN=Lyrm1 PE=1 SV=1
3	Q8K215	7.79e-04	38.1	91	0.172	0.231	LYRM4_MOUSE LYR motif-containing protein 4 OS=Mus musculus OX=10090 GN=Lyrm4 PE=1 SV=1
4	Q6Q560	0.007	35.4	94	0.172	0.223	ISD11_YEAST Protein ISD11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ISD11 PE=1 SV=1
5	Q8R033	0.012	35.0	88	0.172	0.239	LYRM2_MOUSE LYR motif-containing protein 2 OS=Mus musculus OX=10090 GN=Lyrm2 PE=3 SV=1
6	Q0VCG0	0.015	34.7	91	0.189	0.253	LYRM4_BOVIN LYR motif-containing protein 4 OS=Bos taurus OX=9913 GN=LYRM4 PE=3 SV=1
7	Q9HD34	0.015	34.7	91	0.148	0.198	LYRM4_HUMAN LYR motif-containing protein 4 OS=Homo sapiens OX=9606 GN=LYRM4 PE=1 SV=1
8	Q9NU23	0.080	32.7	88	0.172	0.239	LYRM2_HUMAN LYR motif-containing protein 2 OS=Homo sapiens OX=9606 GN=LYRM2 PE=1 SV=1
9	Q91V16	0.51	30.4	86	0.164	0.233	ETFR1_MOUSE Electron transfer flavoprotein regulatory factor 1 OS=Mus musculus OX=10090 GN=Etfrf1 PE=1 SV=1
10	Q22497	5.8	28.5	181	0.213	0.144	Q22497_CAEEL SH2 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_T14G10.8 PE=1 SV=1
11	Q63Z96	7.2	28.1	157	0.172	0.134	Q63Z96_ARATH At1g76060 OS=Arabidopsis thaliana OX=3702 GN=EMB1793 PE=1 SV=1
12	Q8L9E3	8.0	27.3	87	0.197	0.276	Q8L9E3_ARATH At5g61220 OS=Arabidopsis thaliana OX=3702 GN=MAF19.16 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05347 Complex1_LYR	4.2e-09	47.6	Complex 1 protein (LYR family)
2	PF13233 Complex1_LYR_2	1.6e+02	14.4	Complex1_LYR-like
3	PF16740 SKA2	2.9e+02	12.7	Spindle and kinetochore-associated protein 2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000379367

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000414066	0.838	Succinate dehydrogenase assembly factor 3, mitochondrial
2	9606.ENSP00000370761	0.721	Electron transfer flavoprotein regulatory factor 1
3	9606.ENSP00000430025	0.690	LYR motif containing 2
4	9606.ENSP00000368688	0.682	Complex III assembly factor LYRM7
5	9606.ENSP00000420026	0.658	LYR motif-containing protein 4
6	9606.ENSP00000368397	0.654	LYR motif containing 9
7	9606.ENSP00000297534	0.629	Protein FMC1 homolog
8	9606.ENSP00000368165	0.520	Succinate dehydrogenase assembly factor 1, mitochondrial
9	9606.ENSP00000400184	0.519	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 8
10	9606.ENSP00000229903	0.508	SAYSVFN motif domain containing 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0042803	0.468	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016043	0.995	cellular component organization
GO:0022607	0.975	cellular component assembly
GO:0044237	0.969	cellular metabolic process
GO:0006996	0.874	organelle organization
GO:0007005	0.832	mitochondrion organization
GO:0043933	0.556	protein-containing complex organization
GO:0033108	0.548	mitochondrial respiratory chain complex assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0070013	0.999	intracellular organelle lumen
GO:0005654	0.994	nucleoplasm
GO:0005739	0.938	mitochondrion
GO:0030496	0.861	midbody

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]