StarFunc result for job id O43345

User Input

>input (1280 residues)
MGSLTFRDVAIEFSLEEWQCLDTAQQNLYRNVMLENYRNLVFLGIAAFKPDLIIFLEEGK
ESWNMKRHEMVEESPVICSHFAQDLWPEQGIEDSFQKVILRRYEKCGHENLHLKIGYTNV
DECKVHKEGYNKLNQSLTTTQSKVFQRGKYANVFHKCSNSNRHKIRHTGKKHLQCKEYVR
SFCMLSHLSQHKRIYTRENSYKCEEGGKAFNWSSTLTYYKSAHTGEKPYRCKECGKAFSK
FSILTKHKVIHTGEKSYKCEECGKAFNQSAILTKHKIIHTGEKPNKCEECGKAFSKVSTL
TTHKAIHAGEKPYKCKECGKAFSKVSTLITHKAIHAGEKPYKCKECGKAFSKFSILTKHK
VIHTGEKPYKCEECGKAYKWPSTLSYHKKIHTGEKPYKCEECGKGFSMFSILTKHEVIHT
GEKPYKCEECGKAFNWSSNLMEHKKIHTGETPYKCEECGKGFSMFSILTKHKVIHNGEKP
YKCEECDKATHAGEKPYKCEECGKAFNWSSNLMEHKRIHTGEKPYKCEECGKSFSTFSIL
TKHKVIHTGEKPYKCEECGKAYKWSSTLSYHKKIHTVEKPYKCEECGKAFNQSAILIKHK
RIHTGEKPYKCEECGKTFSKVSTLTTHKAIHAGEKPYKCKECGKTFIKVSTLTTHKAIHA
GEKPYKCKECGKAFSKFSILTKHKVIHTGEKPYKCEECGKAFNWSSNLMEHKRIHTGEKP
YKCEECGKSFSTFSVLTKHKVIHTGEKPYKCEECGKAYKWSSTLSYHKKIHTVEKPYKCE
ECGKAFNRSAILIKHKRIHTDEKPYKCEECGKTFSKVSTLTTHKAIHAGEKPYKCKECGK
AFSKFSILTKHKVIHTGEKPYKCEECGKAYKWPSTLSYHKKIHTGEKPYKCEECGKGFSM
FSILTKHEVIHTGEKPYKCEECGKAFSWLSVFSKHKKTHAGEKFYKCEACGKAYKSSSTL
SYHKKIHTEEKPYKYEECGKGFSTFSILTKHKVIHTGEKPYKCEECGKAFNWSSNLMEHK
KIHTGETPYKCEECDKAFSWPSSLTEHKATHAGEKPYKCEECGKAFSWPSRLTEHKATHA
GEEPYKCEECGKAFNWSSNLMEHKRIHTGEKPYKCEECGKSFSTFSILTKHKVIHTGEKP
YKCEECGKAYKWSSTLSYHKKIHTVEKPYKCEECGKGFVMFSILAKHKVIHTGEKLYKCE
ECGKAYKWPSTLRYHKKIHTGEKPYKCEECGKAFSTFSILTKHKVIHTGEKPYKCEECGK
AFSWLSVFSKHKKIHTGEKL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q05481	0.249	0.265	0.000	1191	0.645	0.694	Q05481.pdb.gz	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
2	AFDB:P17038	0.155	0.229	1.347E-75	809	0.431	0.682	P17038.pdb.gz	ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens OX=9606 GN=ZNF43 PE=2 SV=4
3	AFDB:Q14587	0.230	0.295	1.882E-74	947	0.318	0.430	Q14587.pdb.gz	ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens OX=9606 GN=ZNF268 PE=1 SV=2
4	AFDB:Q5DTF8	0.219	0.279	1.805E-73	919	0.395	0.551	Q5DTF8.pdb.gz	Q5DTF8_MOUSE MKIAA4236 protein (Fragment) OS=Mus musculus OX=10090 GN=Zfp748 PE=2 SV=1
5	AFDB:Q9UII5	0.202	0.309	2.631E-73	783	0.413	0.676	Q9UII5.pdb.gz	ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens OX=9606 GN=ZNF107 PE=1 SV=1
6	AFDB:A6NNF4	0.185	0.280	3.696E-71	738	0.422	0.732	A6NNF4.pdb.gz	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
7	AFDB:A0A1B0GR71	0.264	0.317	1.862E-67	966	0.319	0.422	A0A1B0GR71.pdb.gz	A0A1B0GR71_MOUSE Predicted gene 4924 OS=Mus musculus OX=10090 GN=Gm4924 PE=1 SV=1
8	AFDB:Q9P2J8	0.187	0.262	1.015E-66	865	0.312	0.461	Q9P2J8.pdb.gz	ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens OX=9606 GN=ZNF624 PE=1 SV=3
9	AFDB:Q5TYW1	0.166	0.187	1.353E-65	1059	0.345	0.417	Q5TYW1.pdb.gz	ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens OX=9606 GN=ZNF658 PE=1 SV=2
10	AFDB:Q6ZR52	0.195	0.354	1.582E-62	646	0.350	0.693	Q6ZR52.pdb.gz	ZN493_HUMAN Zinc finger protein 493 OS=Homo sapiens OX=9606 GN=ZNF493 PE=1 SV=3
11	PDB:3w5kB	0.047	0.289	4.701E-3	110	0.030	0.345	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:7k041	0.052	0.091	1.861	487	0.046	0.121	7k041.pdb.gz	Cryo-EM structure of TFIIH/Rad4-Rad23-Rad33 in damaged DNA opening in nucleotide excision repair.
13	PDB:5ijnC	0.064	0.095	1.951	636	0.047	0.094	5ijnC.pdb.gz
14	PDB:6hivCv	0.036	0.039	1.951	1059	0.056	0.068	6hivCv.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
15	PDB:7ena4	0.046	0.092	2.045	457	0.024	0.068	7ena4.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
16	PDB:7vciU	0.062	0.073	2.144	820	0.084	0.132	7vciU.pdb.gz
17	PDB:6hivDD	0.055	0.074	2.247	791	0.063	0.102	6hivDD.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
18	PDB:7o4i1	0.056	0.084	2.247	522	0.050	0.123	7o4i1.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
19	PDB:7c4jB	0.035	0.084	2.356	395	0.038	0.124	7c4jB.pdb.gz
20	PDB:7cunA	0.064	0.084	3.276	730	0.036	0.063	7cunA.pdb.gz	Identification of Integrator-PP2A complex (INTAC), an RNA polymerase II phosphatase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0U1RQ46	575	609	0.229	0.481	A0A0U1RQ46_MOUSE Zinc finger protein 950 OS=Mus musculus OX=10090 GN=Zfp950 PE=4 SV=1
2	A0A1B0GR71	633	966	0.282	0.374	A0A1B0GR71_MOUSE Predicted gene 4924 OS=Mus musculus OX=10090 GN=Gm4924 PE=1 SV=1
3	A0A8I6G8Y2	553	723	0.245	0.434	A0A8I6G8Y2_RAT Zinc finger protein 111 OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=4 SV=1
4	A6NNF4	553	616	0.231	0.481	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
5	A8K8Y5	561	707	0.220	0.397	A8K8Y5_HUMAN cDNA FLJ78762, highly similar to Homo sapiens zinc finger protein 224, mRNA OS=Homo sapiens OX=9606 PE=1 SV=1
6	G3V9G6	574	740	0.254	0.439	G3V9G6_RAT Zinc finger protein 111 OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=4 SV=4
7	O75290	551	641	0.224	0.448	Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens OX=9606 GN=ZNF780A PE=1 SV=3
8	O75437	573	659	0.246	0.478	ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens OX=9606 GN=ZNF254 PE=2 SV=3
9	P15620	555	580	0.216	0.476	ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus OX=10090 GN=Znf271 PE=2 SV=1
10	P17020	551	682	0.210	0.394	ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens OX=9606 GN=ZNF16 PE=1 SV=3
11	P17027	557	643	0.223	0.445	ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens OX=9606 GN=ZNF23 PE=1 SV=3
12	P17038	1032	809	0.422	0.667	ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens OX=9606 GN=ZNF43 PE=2 SV=4
13	P35789	599	620	0.240	0.495	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
14	P51523	556	738	0.227	0.393	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
15	Q02386	553	682	0.223	0.419	ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens OX=9606 GN=ZNF45 PE=1 SV=2
16	Q03923	556	595	0.231	0.497	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3
17	Q03936	558	586	0.225	0.491	ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens OX=9606 GN=ZNF92 PE=1 SV=2
18	Q05481	1218	1191	0.513	0.552	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
19	Q14587	693	947	0.291	0.394	ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens OX=9606 GN=ZNF268 PE=1 SV=2
20	Q14593	727	569	0.289	0.650	ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens OX=9606 GN=ZNF273 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12552 DUF3741	0.34	22.1	Protein of unknown function (DUF3741)
2	PF20026 DUF6434	5.6	18.4	Domain of unknown function (DUF6434)
3	PF12773 DZR	4.3e-05	34.7	Double zinc ribbon
4	PF01155 HypA	5.9	18.4	Hydrogenase/urease nickel incorporation, metallochaperone, hypA
5	PF01352 KRAB	1.1e-19	81.1	KRAB box
6	PF10484 MRP-S23	1.2	20.9	Mitochondrial ribosomal protein S23
7	PF01286 XPA_N	2.1e-24	96.6	XPA protein N-terminal
8	PF01428 zf-AN1	0.0023	29.3	AN1-like Zinc finger
9	PF00096 zf-C2H2	1.4e-121	401.7	Zinc finger, C2H2 type
10	PF16622 zf-C2H2_11	6.3e-28	107.5	zinc-finger C2H2-type
11	PF13894 zf-C2H2_4	5.1e-71	240.1	C2H2-type zinc finger
12	PF13912 zf-C2H2_6	3.8e-66	229.2	C2H2-type zinc finger
13	PF12171 zf-C2H2_jaz	8.5e-26	100.9	Zinc-finger double-stranded RNA-binding
14	PF13465 zf-H2C2_2	2.1e-277	896.1	Zinc-finger double domain
15	PF02591 zf-RING_7	0.15	23.5	C4-type zinc ribbon domain
16	PF13451 zf-trcl	1.7	19.9	Probable zinc-ribbon domain
17	PF18439 zf_UBZ	8.2e-31	116.7	Ubiquitin-Binding Zinc Finger
18	PF17032 zinc_ribbon_15	92	15.2	zinc-ribbon family
19	PF09723 Zn-ribbon_8	5.2e-29	111.4	Zinc ribbon domain
20	PF17283 Zn_ribbon_SprT	6	18.3	SprT-like zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000380315

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000378161	0.803	Acylphosphatase-2
2	9606.ENSP00000224950	0.690	CST complex subunit STN1
3	9606.ENSP00000353332	0.681	Regulator of telomere elongation helicase 1
4	9606.ENSP00000313759	0.615	CST complex subunit CTC1
5	9606.ENSP00000258169	0.608	M-phase phosphoprotein 6
6	9606.ENSP00000351147	0.563	DDB1- and CUL4-associated factor 4
7	9606.ENSP00000274054	0.523	H/ACA ribonucleoprotein complex non-core subunit NAF1
8	9606.ENSP00000309572	0.506	Telomerase reverse transcriptase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.507	heterocyclic compound binding
GO:0097159	0.507	organic cyclic compound binding
GO:0003676	0.450	nucleic acid binding
GO:0003677	0.337	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0019219	0.997	regulation of nucleobase-containing compound metabolic process
GO:0048523	0.996	negative regulation of cellular process
GO:0010556	0.996	regulation of macromolecule biosynthetic process
GO:0031326	0.996	regulation of cellular biosynthetic process
GO:0010605	0.994	negative regulation of macromolecule metabolic process
GO:0045934	0.993	negative regulation of nucleobase-containing compound metabolic process
GO:0006355	0.990	regulation of DNA-templated transcription
GO:0045892	0.981	negative regulation of DNA-templated transcription
GO:0009987	0.573	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.978	nuclear lumen
GO:0005654	0.974	nucleoplasm
GO:0032991	0.384	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]