StarFunc result for job id O43353

User Input

>input (540 residues)
MNGEAICSALPTIPYHKLADLRYLSRGASGTVSSARHADWRVQVAVKHLHIHTPLLDSER
KDVLREAEILHKARFSYILPILGICNEPEFLGIVTEYMPNGSLNELLHRKTEYPDVAWPL
RFRILHEIALGVNYLHNMTPPLLHHDLKTQNILLDNEFHVKIADFGLSKWRMMSLSQSRS
SKSAPEGGTIIYMPPENYEPGQKSRASIKHDIYSYAVITWEVLSRKQPFEDVTNPLQIMY
SVSQGHRPVINEESLPYDIPHRARMISLIESGWAQNPDERPSFLKCLIELEPVLRTFEEI
TFLEAVIQLKKTKLQSVSSAIHLCDKKKMELSLNIPVNHGPQEESCGSSQLHENSGSPET
SRSLPAPQDNDFLSRKAQDCYFMKLHHCPGNHSWDSTISGSQRAAFCDHKTTPCSSAIIN
PLSTAGNSERLQPGIAQQWIQSKREDIVNQMTEACLNQSLDALLSRDLIMKEDYELVSTK
PTRTSKVRQLLDTTDIQGEEFAKVIVQKLKDNKQMGLQPYPEILVVSRSPSLNLLQNKSM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0S2Z4Z8	0.634	0.634	7.446E-75	540	1.000	1.000	A0A0S2Z4Z8.pdb.gz	A0A0S2Z4Z8_HUMAN Receptor-interacting serine-threonine kinase 2 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=RIPK2 PE=2 SV=1
2	AFDB:P58801	0.613	0.614	1.813E-70	539	0.843	0.844	P58801.pdb.gz	RIPK2_MOUSE Receptor-interacting serine/threonine-protein kinase 2 OS=Mus musculus OX=10090 GN=Ripk2 PE=1 SV=1
3	AFDB:A0A060WPC3	0.576	0.528	4.661E-49	589	0.526	0.482	A0A060WPC3.pdb.gz	A0A060WPC3_ONCMY Receptor-interacting serine/threonine-protein kinase 2 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00058388001 PE=4 SV=1
4	AFDB:Q4V958	0.596	0.553	1.551E-48	584	0.528	0.488	Q4V958.pdb.gz	Q4V958_DANRE Receptor-interacting serine/threonine-protein kinase 2 OS=Danio rerio OX=7955 GN=RICK PE=2 SV=1
5	AFDB:A5A8K0	0.566	0.729	1.115E-39	418	0.396	0.512	A5A8K0.pdb.gz
6	AFDB:Q9LT87	0.414	0.341	5.723E-15	663	0.172	0.140	Q9LT87.pdb.gz	Q9LT87_ARATH At3g19300 OS=Arabidopsis thaliana OX=3702 GN=At3g19300 PE=1 SV=1
7	AFDB:C0LGU1	0.418	0.241	9.257E-15	959	0.169	0.095	C0LGU1.pdb.gz	Y5374_ARATH Probable LRR receptor-like serine/threonine-protein kinase At5g37450 OS=Arabidopsis thaliana OX=3702 GN=At5g37450 PE=1 SV=1
8	AFDB:O73613	0.446	0.393	1.177E-14	616	0.226	0.198	O73613.pdb.gz	O73613_XENLA Mitogen-activated protein kinase kinase kinase 7 OS=Xenopus laevis OX=8355 GN=map3k7.L PE=2 SV=1
9	AFDB:Q9FG24	0.431	0.324	1.649E-14	735	0.144	0.106	Q9FG24.pdb.gz	SRF2_ARATH Protein STRUBBELIG-RECEPTOR FAMILY 2 OS=Arabidopsis thaliana OX=3702 GN=SRF2 PE=1 SV=1
10	AFDB:Q54TM7	0.441	0.191	2.667E-14	1288	0.207	0.087	Q54TM7.pdb.gz	DRKD_DICDI Probable serine/threonine-protein kinase drkD OS=Dictyostelium discoideum OX=44689 GN=drkD PE=2 SV=1
11	PDB:7mfdA	0.439	0.567	1.738E-13	410	0.154	0.202	7mfdA.pdb.gz	Structural insights into the BRAF monomer-to-dimer transition mediated by RAS binding.
12	PDB:6lk5A	0.425	0.830	2.107E-13	265	0.128	0.260	6lk5A.pdb.gz
13	PDB:4btfA	0.405	0.518	2.434E-13	413	0.133	0.174	4btfA.pdb.gz
14	PDB:8dksA	0.404	0.730	2.811E-13	283	0.139	0.265	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
15	PDB:4k2rA	0.404	0.396	2.950E-13	551	0.137	0.134	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
16	PDB:4fl2A	0.434	0.423	4.334E-13	555	0.137	0.133	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
17	PDB:2h8hA	0.432	0.519	6.368E-13	445	0.133	0.162	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
18	PDB:2qkwB	0.379	0.662	1.375E-12	292	0.144	0.267	2qkwB.pdb.gz
19	PDB:3eqdA	0.454	0.750	2.828E-12	315	0.117	0.200	3eqdA.pdb.gz	Crystal Structures of MEK1 Binary and Ternary Complexes with Nucleotides and Inhibitors.
20	PDB:6s73A	0.420	0.806	3.774E-12	269	0.093	0.186	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z4Z8	0.0	1122	540	1.000	1.000	A0A0S2Z4Z8_HUMAN Receptor-interacting serine-threonine kinase 2 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=RIPK2 PE=2 SV=1
2	O43353	0.0	1122	540	1.000	1.000	RIPK2_HUMAN Receptor-interacting serine/threonine-protein kinase 2 OS=Homo sapiens OX=9606 GN=RIPK2 PE=1 SV=2
3	P58801	0.0	944	539	0.843	0.844	RIPK2_MOUSE Receptor-interacting serine/threonine-protein kinase 2 OS=Mus musculus OX=10090 GN=Ripk2 PE=1 SV=1
4	Q4V958	1.82e-145	432	584	0.367	0.339	Q4V958_DANRE Receptor-interacting serine/threonine-protein kinase 2 OS=Danio rerio OX=7955 GN=RICK PE=2 SV=1
5	A0A060WPC3	2.02e-144	430	589	0.380	0.348	A0A060WPC3_ONCMY Receptor-interacting serine/threonine-protein kinase 2 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00058388001 PE=4 SV=1
6	Q9ERK0	1.96e-59	212	786	0.263	0.181	RIPK4_MOUSE Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus OX=10090 GN=Ripk4 PE=1 SV=2
7	Q9H4D1	1.38e-57	207	784	0.224	0.154	Q9H4D1_HUMAN Protein kinase OS=Homo sapiens OX=9606 GN=dik PE=2 SV=1
8	P57078	3.69e-57	206	832	0.220	0.143	RIPK4_HUMAN Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens OX=9606 GN=RIPK4 PE=1 SV=1
9	Q8NFD2	1.19e-52	193	765	0.235	0.166	ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ANKK1 PE=1 SV=1
10	Q8BZ25	1.92e-52	192	745	0.200	0.145	ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus OX=10090 GN=Ankk1 PE=2 SV=1
11	A0A1D5NSB4	1.58e-41	158	513	0.261	0.275	A0A1D5NSB4_DANRE Adhesion G protein-coupled receptor G1 OS=Danio rerio OX=7955 GN=si:dkey-181f22.4 PE=4 SV=1
12	Q9Y572	5.80e-36	142	518	0.181	0.189	RIPK3_HUMAN Receptor-interacting serine/threonine-protein kinase 3 OS=Homo sapiens OX=9606 GN=RIPK3 PE=1 SV=2
13	D3ZYL0	1.55e-35	143	658	0.189	0.155	D3ZYL0_RAT Receptor interacting serine/threonine kinase 1 OS=Rattus norvegicus OX=10116 GN=Ripk1 PE=1 SV=1
14	Q05609	7.76e-35	142	821	0.170	0.112	CTR1_ARATH Serine/threonine-protein kinase CTR1 OS=Arabidopsis thaliana OX=3702 GN=CTR1 PE=1 SV=1
15	Q60855	1.09e-34	140	656	0.196	0.162	RIPK1_MOUSE Receptor-interacting serine/threonine-protein kinase 1 OS=Mus musculus OX=10090 GN=Ripk1 PE=1 SV=1
16	Q54H46	4.08e-33	135	642	0.167	0.140	DRKA_DICDI Probable serine/threonine-protein kinase drkA OS=Dictyostelium discoideum OX=44689 GN=drkA PE=3 SV=1
17	Q9FPR3	4.09e-33	137	933	0.174	0.101	EDR1_ARATH Serine/threonine-protein kinase EDR1 OS=Arabidopsis thaliana OX=3702 GN=EDR1 PE=1 SV=1
18	Q0MSH9	1.28e-32	134	661	0.163	0.133	Q0MSH9_DANRE Receptor-interacting protein 1 OS=Danio rerio OX=7955 GN=rip1 PE=2 SV=1
19	Q13546	1.57e-32	134	671	0.161	0.130	RIPK1_HUMAN Receptor-interacting serine/threonine-protein kinase 1 OS=Homo sapiens OX=9606 GN=RIPK1 PE=1 SV=3
20	Q54TM7	4.51e-32	134	1288	0.170	0.071	DRKD_DICDI Probable serine/threonine-protein kinase drkD OS=Dictyostelium discoideum OX=44689 GN=drkD PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00619 CARD	2.9e-15	67.3	Caspase recruitment domain
2	PF06293 Kdo	3.4e+02	12.0	Lipopolysaccharide kinase (Kdo/WaaP) family
3	PF00069 Pkinase	4.9e-39	145.9	Protein kinase domain
4	PF07714 PK_Tyr_Ser-Thr	6.2e-40	148.7	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000220751

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000222823	0.999	Nucleotide-binding oligomerization domain-containing protein 1
2	9606.ENSP00000300589	0.999	Nucleotide-binding oligomerization domain-containing protein 2
3	9606.ENSP00000360242	0.999	E3 ubiquitin-protein ligase XIAP
4	9606.ENSP00000483825	0.997	NF-kappa-B essential modulator
5	9606.ENSP00000172229	0.996	Tumor necrosis factor receptor superfamily member 16
6	9606.ENSP00000454207	0.994	TNF receptor-associated factor 3
7	9606.ENSP00000477613	0.993	Baculoviral IAP repeat-containing protein 2
8	9606.ENSP00000433623	0.988	TNF receptor-associated factor 6
9	9606.ENSP00000263464	0.982	Baculoviral IAP repeat-containing protein 3
10	9606.ENSP00000247668	0.973	TNF receptor-associated factor 2
11	9606.ENSP00000254691	0.971	Caspase recruitment domain-containing protein 6
12	9606.ENSP00000312455	0.964	CASP8 and FADD-like apoptosis regulator
13	9606.ENSP00000401399	0.962	Myeloid differentiation primary response protein MyD88
14	9606.ENSP00000359612	0.956	B-cell lymphoma/leukemia 10
15	9606.ENSP00000351273	0.951	Caspase-8
16	9606.ENSP00000358335	0.949	Mitogen-activated protein kinase kinase kinase 7
17	9606.ENSP00000335153	0.948	Heat shock protein HSP 90-alpha
18	9606.ENSP00000430684	0.943	Inhibitor of nuclear factor kappa-B kinase subunit beta
19	9606.ENSP00000301838	0.941	FAS-associated death domain protein
20	9606.ENSP00000359424	0.941	Inhibitor of nuclear factor kappa-B kinase subunit alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019899	0.996	enzyme binding
GO:0004674	0.996	protein serine/threonine kinase activity
GO:0019904	0.995	protein domain specific binding
GO:0005102	0.995	signaling receptor binding
GO:0042803	0.995	protein homodimerization activity
GO:0002020	0.991	protease binding
GO:0089720	0.822	caspase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0048518	0.996	positive regulation of biological process
GO:0009607	0.995	response to biotic stimulus
GO:0051716	0.995	cellular response to stimulus
GO:0010033	0.995	response to organic substance
GO:0060255	0.995	regulation of macromolecule metabolic process
GO:0007166	0.991	cell surface receptor signaling pathway
GO:0010628	0.989	positive regulation of gene expression
GO:0051173	0.988	positive regulation of nitrogen compound metabolic process
GO:0008152	0.987	metabolic process
GO:0071310	0.987	cellular response to organic substance
GO:0032103	0.987	positive regulation of response to external stimulus
GO:0045087	0.987	innate immune response
GO:0051240	0.986	positive regulation of multicellular organismal process
GO:0031349	0.986	positive regulation of defense response
GO:1902533	0.986	positive regulation of intracellular signal transduction
GO:0002757	0.986	immune response-activating signaling pathway
GO:1901700	0.985	response to oxygen-containing compound
GO:1901698	0.985	response to nitrogen compound
GO:0002833	0.985	positive regulation of response to biotic stimulus
GO:0051092	0.985	positive regulation of NF-kappaB transcription factor activity
GO:0002221	0.984	pattern recognition receptor signaling pathway
GO:0001819	0.982	positive regulation of cytokine production
GO:0043122	0.981	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0050852	0.978	T cell receptor signaling pathway
GO:0030522	0.975	intracellular receptor signaling pathway
GO:0043123	0.973	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0002753	0.969	cytosolic pattern recognition receptor signaling pathway
GO:0002220	0.967	innate immune response activating cell surface receptor signaling pathway
GO:0051246	0.962	regulation of protein metabolic process
GO:0051247	0.931	positive regulation of protein metabolic process
GO:0071704	0.927	organic substance metabolic process
GO:0009617	0.920	response to bacterium
GO:0031325	0.919	positive regulation of cellular metabolic process
GO:0044238	0.917	primary metabolic process
GO:1901564	0.915	organonitrogen compound metabolic process
GO:0043170	0.914	macromolecule metabolic process
GO:0019538	0.895	protein metabolic process
GO:0010941	0.887	regulation of cell death
GO:0010942	0.876	positive regulation of cell death
GO:1901701	0.872	cellular response to oxygen-containing compound
GO:0031399	0.840	regulation of protein modification process
GO:0042327	0.840	positive regulation of phosphorylation
GO:0043085	0.815	positive regulation of catalytic activity
GO:0031401	0.808	positive regulation of protein modification process
GO:0044237	0.790	cellular metabolic process
GO:0048519	0.785	negative regulation of biological process
GO:0032501	0.763	multicellular organismal process
GO:0009894	0.762	regulation of catabolic process
GO:0010605	0.720	negative regulation of macromolecule metabolic process
GO:0043067	0.715	regulation of programmed cell death
GO:0035556	0.713	intracellular signal transduction
GO:0031328	0.672	positive regulation of cellular biosynthetic process
GO:0033554	0.667	cellular response to stress
GO:0042981	0.667	regulation of apoptotic process
GO:0071495	0.658	cellular response to endogenous stimulus
GO:0042127	0.559	regulation of cell population proliferation
GO:0050793	0.556	regulation of developmental process
GO:0010243	0.552	response to organonitrogen compound
GO:0048523	0.548	negative regulation of cellular process
GO:0045595	0.545	regulation of cell differentiation
GO:0010467	0.536	gene expression
GO:0042742	0.521	defense response to bacterium
GO:0043412	0.429	macromolecule modification
GO:0045935	0.414	positive regulation of nucleobase-containing compound metabolic process
GO:0032502	0.387	developmental process
GO:0048856	0.377	anatomical structure development
GO:0036211	0.323	protein modification process
GO:0008284	0.319	positive regulation of cell population proliferation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043227	0.849	membrane-bounded organelle
GO:0043229	0.840	intracellular organelle
GO:0043231	0.685	intracellular membrane-bounded organelle
GO:0016020	0.305	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.996	Phosphotransferases with an alcohol group as acceptor.

[back to server]