StarFunc result for job id O43379

User Input

>input (1518 residues)
MAAVGSGGYARNDAGEKLPSVMAGVPARRGQSSPPPAPPICLRRRTRLSTASEETVQNRV
SLEKVLGITAQNSSGLTCDPGTGHVAYLAGCVVVILDPKENKQQHIFNTARKSLSALAFS
PDGKYIVTGENGHRPAVRIWDVEEKNQVAEMLGHKYGVACVAFSPNMKHIVSMGYQHDMV
LNVWDWKKDIVVASNKVSCRVIALSFSEDSSYFVTVGNRHVRFWFLEVSTETKVTSTVPL
VGRSGILGELHNNIFCGVACGRGRMAGSTFCVSYSGLLCQFNEKRVLEKWINLKVSLSSC
LCVSQELIFCGCTDGIVRIFQAHSLHYLANLPKPHYLGVDVAQGLEPSFLFHRKAEAVYP
DTVALTFDPIHQWLSCVYKDHSIYIWDVKDINRVGKVWSELFHSSYVWNVEVYPEFEDQR
ACLPSGSFLTCSSDNTIRFWNLDSSPDSHWQKNIFSNTLLKVVYVENDIQHLQDMSHFPD
RGSENGTPMDVKAGVRVMQVSPDGQHLASGDRSGNLRIHELHFMDELVKVEAHDAEVLCL
EYSKPETGLTLLASASRDRLIHVLNVEKNYNLEQTLDDHSSSITAIKFAGNRDIQMISCG
ADKSIYFRSAQQGSDGLHFVRTHHVAEKTTLYDMDIDITQKYVAVACQDRNVRVYNTVNG
KQKKCYKGSQGDEGSLLKVHVDPSGTFLATSCSDKSISVIDFYSGECIAKMFGHSEIITS
MKFTYDCHHLITVSGDSCVFIWHLGPEITNCMKQHLLEIDHRQQQQHTNDKKRSGHPRQD
TYVSTPSEIHSLSPGEQTEDDLEEECEPEEMLKTPSKDSLDPDPRCLLTNGKLPLWAKRL
LGDDDVADGLAFHAKRSYQPHGRWAERAGQEPLKTILDAQDLDCYFTPMKPESLENSILD
SLEPQSLASLLSESESPQEAGRGHPSFLPQQKESSEASELILYSLEAEVTVTGTDSQYCR
KEVEAGPGDQQGDSYLRVSSDSPKDQSPPEDSGESEADLECSFAAIHSPAPPPDPAPRFA
TSLPHFPGCAGPTEDELSLPEGPSVPSSSLPQTPEQEKFLRHHFETLTESPCRALGDVEA
SEAEDHFFNPRLSISTQFLSSLQKASRFTHTFPPRATQCLVKSPEVKLMDRGGSQPRAGT
GYASPDRTHVLAAGKAEETLEAWRPPPPCLTSLASCVPASSVLPTDRNLPTPTSAPTPGL
AQGVHAPSTCSYMEATASSRARISRSISLGDSEGPIVATLAQPLRRPSSVGELASLGQEL
QAITTATTPSLDSEGQEPALRSWGNHEARANLRLTLSSACDGLLQPPVDTQPGVTVPAVS
FPAPSPVEESALRLHGSAFRPSLPAPESPGLPAHPSNPQLPEARPGIPGGTASLLEPTSG
ALGLLQGSPARWSEPWVPVEALPPSPLELSRVGNILHRLQTTFQEALDLYRVLVSSGQVD
TGQQQARTELVSTFLWIHSQLEAECLVGTSVAPAQALPSPGPPSPPTLYPLASPDLQALL
EHYSELLVQAVRRKARGH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1LRR4	0.585	0.573	0.000	1551	0.773	0.757	F1LRR4.pdb.gz	F1LRR4_RAT WD repeat domain 62 OS=Rattus norvegicus OX=10116 GN=Wdr62 PE=1 SV=4
2	AFDB:O43379	1.000	1.000	0.000	1518	1.000	1.000	O43379.pdb.gz	WDR62_HUMAN WD repeat-containing protein 62 OS=Homo sapiens OX=9606 GN=WDR62 PE=1 SV=4
3	AFDB:O60336	0.484	0.485	0.000	1514	0.400	0.401	O60336.pdb.gz	MABP1_HUMAN Mitogen-activated protein kinase-binding protein 1 OS=Homo sapiens OX=9606 GN=MAPKBP1 PE=1 SV=4
4	AFDB:Q6NS57	0.496	0.501	0.000	1503	0.410	0.415	Q6NS57.pdb.gz	MABP1_MOUSE Mitogen-activated protein kinase-binding protein 1 OS=Mus musculus OX=10090 GN=Mapkbp1 PE=1 SV=1
5	AFDB:M9PB01	0.456	0.291	2.587E-100	2397	0.312	0.197	M9PB01.pdb.gz	M9PB01_DROME WD repeat domain 62, isoform G OS=Drosophila melanogaster OX=7227 GN=Wdr62 PE=4 SV=1
6	AFDB:Q3MHU0	0.048	0.090	9.439E-40	740	0.308	0.632	Q3MHU0.pdb.gz	Q3MHU0_RAT Wdr62 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Wdr62 PE=2 SV=1
7	PDB:7rroe	0.360	0.850	6.789E-34	610	0.078	0.195	7rroe.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
8	PDB:7mq8LR	0.284	0.485	2.758E-32	773	0.070	0.137	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
9	PDB:7mqaLQ	0.304	0.509	3.860E-31	830	0.069	0.125	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
10	PDB:7mqaLO	0.330	0.574	4.113E-29	819	0.059	0.109	7mqaLO.pdb.gz	Nucleolar maturation of the human small subunit processome.
11	PDB:7mq8LO	0.322	0.538	5.301E-29	848	0.057	0.103	7mq8LO.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	PDB:1nr0A	0.344	0.801	7.188E-29	610	0.054	0.134	1nr0A.pdb.gz
13	PDB:6lqsB1	0.328	0.576	1.256E-28	806	0.072	0.135	6lqsB1.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
14	PDB:7ajuUL	0.300	0.527	3.131E-28	779	0.064	0.125	7ajuUL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
15	PDB:7ajtUA	0.326	0.556	3.294E-28	834	0.069	0.126	7ajtUA.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
16	PDB:7mq8LT	0.294	0.468	1.058E-27	869	0.057	0.100	7mq8LT.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	AFDB:Q9C0J8	0.178	0.201	7.560E-15	1336	0.105	0.119	Q9C0J8.pdb.gz	WDR33_HUMAN pre-mRNA 3' end processing protein WDR33 OS=Homo sapiens OX=9606 GN=WDR33 PE=1 SV=2
18	AFDB:Q9VC96	0.173	0.121	1.462E-6	2232	0.142	0.096	Q9VC96.pdb.gz	Q9VC96_DROME BRWD3 OS=Drosophila melanogaster OX=7227 GN=BRWD3 PE=1 SV=2
19	AFDB:Q17602	0.117	0.127	3.465E-6	1390	0.118	0.129	Q17602.pdb.gz	NU214_CAEEL Nuclear pore complex protein 14 OS=Caenorhabditis elegans OX=6239 GN=npp-14 PE=1 SV=1
20	AFDB:O55005	0.052	0.049	2.638E-5	1651	0.128	0.118	O55005.pdb.gz	ROBO1_RAT Roundabout homolog 1 OS=Rattus norvegicus OX=10116 GN=Robo1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JZG6	0.0	2312	1526	0.780	0.776	A0A0G2JZG6_RAT WD repeat domain 62 OS=Rattus norvegicus OX=10116 GN=Wdr62 PE=1 SV=1
2	A0A0G2K8E8	0.0	2148	1505	0.744	0.750	A0A0G2K8E8_RAT WD repeat domain 62 OS=Rattus norvegicus OX=10116 GN=Wdr62 PE=1 SV=2
3	A8DYT1	0.0	751	1539	0.252	0.248	A8DYT1_DROME WD repeat domain 62, isoform D OS=Drosophila melanogaster OX=7227 GN=Wdr62 PE=4 SV=1
4	F1LRR4	0.0	2234	1541	0.765	0.754	F1LRR4_RAT WD repeat domain 62 OS=Rattus norvegicus OX=10116 GN=Wdr62 PE=1 SV=4
5	F1M5K2	0.0	2300	1551	0.781	0.764	F1M5K2_RAT WD repeat domain 62 OS=Rattus norvegicus OX=10116 GN=Wdr62 PE=1 SV=2
6	M9NE65	0.0	751	1554	0.252	0.246	M9NE65_DROME WD repeat domain 62, isoform F OS=Drosophila melanogaster OX=7227 GN=Wdr62 PE=4 SV=1
7	M9PB01	0.0	753	2397	0.252	0.159	M9PB01_DROME WD repeat domain 62, isoform G OS=Drosophila melanogaster OX=7227 GN=Wdr62 PE=4 SV=1
8	M9PBP2	0.0	756	1476	0.255	0.262	M9PBP2_DROME WD repeat domain 62, isoform H OS=Drosophila melanogaster OX=7227 GN=Wdr62 PE=4 SV=1
9	O43379	0.0	3131	1518	1.000	1.000	WDR62_HUMAN WD repeat-containing protein 62 OS=Homo sapiens OX=9606 GN=WDR62 PE=1 SV=4
10	Q0E8U6	0.0	751	1504	0.252	0.255	Q0E8U6_DROME RE21455p OS=Drosophila melanogaster OX=7227 GN=Wdr62 PE=2 SV=1
11	Q0E8U7	0.0	753	2347	0.252	0.163	Q0E8U7_DROME WD repeat domain 62, isoform C OS=Drosophila melanogaster OX=7227 GN=Wdr62 PE=4 SV=1
12	Q3MHU0	0.0	765	740	0.309	0.634	Q3MHU0_RAT Wdr62 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Wdr62 PE=2 SV=1
13	Q5M9F2	0.0	722	697	0.284	0.618	Q5M9F2_RAT Wdr62 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Wdr62 PE=2 SV=1
14	Q9VQ54	0.0	755	1508	0.255	0.257	Q9VQ54_DROME FI05392p OS=Drosophila melanogaster OX=7227 GN=Wdr62 PE=2 SV=2
15	Q960J6	1.06e-132	443	1183	0.161	0.206	Q960J6_DROME LD47622p OS=Drosophila melanogaster OX=7227 GN=Wdr62 PE=2 SV=1
16	Q9D4T2	4.26e-17	86.3	304	0.045	0.224	Q9D4T2_MOUSE Uncharacterized protein OS=Mus musculus OX=10090 GN=Daw1 PE=2 SV=1
17	D3Z7A5	1.60e-15	83.2	415	0.045	0.164	DAW1_MOUSE Dynein assembly factor with WD repeat domains 1 OS=Mus musculus OX=10090 GN=Daw1 PE=2 SV=1
18	Q8N1V2	1.09e-13	78.6	620	0.035	0.085	CFA52_HUMAN Cilia- and flagella-associated protein 52 OS=Homo sapiens OX=9606 GN=CFAP52 PE=1 SV=3
19	Q8N136	1.81e-13	76.6	415	0.042	0.154	DAW1_HUMAN Dynein assembly factor with WD repeat domains 1 OS=Homo sapiens OX=9606 GN=DAW1 PE=1 SV=1
20	E1BKF9	2.08e-13	77.4	623	0.034	0.082	CFA52_BOVIN Cilia- and flagella-associated protein 52 OS=Bos taurus OX=9913 GN=CFAP52 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	4.3e-12	57.5	Anaphase-promoting complex subunit 4 WD40 domain
2	PF08662 eIF2A	2.2	19.7	Eukaryotic translation initiation factor eIF2A
3	PF20426 NBCH_WD40	3.9	17.8	Neurobeachin beta propeller domain
4	PF00400 WD40	2e-29	112.4	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000384792

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000356379	0.969	Abnormal spindle-like microcephaly-associated protein
2	9606.ENSP00000343818	0.945	CDK5 regulatory subunit-associated protein 2
3	9606.ENSP00000370337	0.940	Centrosomal protein of 152 kDa
4	9606.ENSP00000355500	0.934	Centrosomal protein of 170 kDa
5	9606.ENSP00000371308	0.928	Centromere protein J
6	9606.ENSP00000360944	0.919	SCL-interrupting locus protein
7	9606.ENSP00000257287	0.896	Centrosomal protein of 135 kDa
8	9606.ENSP00000378974	0.872	Mitogen-activated protein kinase 8
9	9606.ENSP00000342924	0.867	Microcephalin
10	9606.ENSP00000336524	0.852	Centrosomal protein of 63 kDa
11	9606.ENSP00000335463	0.790	Kinetochore scaffold 1
12	9606.ENSP00000381070	0.785	Dual specificity mitogen-activated protein kinase kinase 7
13	9606.ENSP00000394560	0.767	Mitogen-activated protein kinase 9
14	9606.ENSP00000360266	0.746	Transcription factor AP-1
15	9606.ENSP00000216911	0.730	Aurora kinase A
16	9606.ENSP00000325326	0.690	Zinc finger protein 335
17	9606.ENSP00000385312	0.671	Mitochondrial thiamine pyrophosphate carrier
18	9606.ENSP00000251413	0.655	Tubulin gamma-1 chain
19	9606.ENSP00000379643	0.652	Nuclear distribution protein nudE homolog 1
20	9606.ENSP00000388620	0.648	Eomesodermin homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0032886	0.992	regulation of microtubule-based process
GO:0048522	0.990	positive regulation of cellular process
GO:0050793	0.985	regulation of developmental process
GO:0046605	0.976	regulation of centrosome cycle
GO:2001222	0.971	regulation of neuron migration
GO:2000179	0.968	positive regulation of neural precursor cell proliferation
GO:1902692	0.964	regulation of neuroblast proliferation
GO:0050767	0.960	regulation of neurogenesis
GO:0050769	0.954	positive regulation of neurogenesis
GO:2001224	0.953	positive regulation of neuron migration
GO:0002052	0.930	positive regulation of neuroblast proliferation
GO:0009987	0.874	cellular process
GO:0045664	0.771	regulation of neuron differentiation
GO:0071840	0.615	cellular component organization or biogenesis
GO:0016043	0.519	cellular component organization
GO:0000226	0.447	microtubule cytoskeleton organization
GO:0022402	0.417	cell cycle process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005819	0.999	spindle
GO:0005634	0.998	nucleus
GO:0005815	0.996	microtubule organizing center
GO:0005829	0.978	cytosol
GO:0005813	0.975	centrosome
GO:0070013	0.970	intracellular organelle lumen
GO:0031981	0.964	nuclear lumen
GO:0005654	0.911	nucleoplasm
GO:0000922	0.894	spindle pole
GO:0034451	0.638	centriolar satellite

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]