StarFunc result for job id O43390

User Input

>input (633 residues)
MANQVNGNAVQLKEEEEPMDTSSVTHTEHYKTLIEAGLPQKVAERLDEIFQTGLVAYVDL
DERAIDALREFNEEGALSVLQQFKESDLSHVQNKSAFLCGVMKTYRQREKQGSKVQESTK
GPDEAKIKALLERTGYTLDVTTGQRKYGGPPPDSVYSGVQPGIGTEVFVGKIPRDLYEDE
LVPLFEKAGPIWDLRLMMDPLSGQNRGYAFITFCGKEAAQEAVKLCDSYEIRPGKHLGVC
ISVANNRLFVGSIPKNKTKENILEEFSKVTEGLVDVILYHQPDDKKKNRGFCFLEYEDHK
SAAQARRRLMSGKVKVWGNVVTVEWADPVEEPDPEVMAKVKVLFVRNLATTVTEEILEKS
FSEFGKLERVKKLKDYAFVHFEDRGAAVKAMDEMNGKEIEGEEIEIVLAKPPDKKRKERQ
AARQASRSTAYEDYYYHPPPRMPPPIRGRGRGGGRGGYGYPPDYYGYEDYYDDYYGYDYH
DYRGGYEDPYYGYDDGYAVRGRGGGRGGRGAPPPPRGRGAPPPRGRAGYSQRGAPLGPPR
GSRGGRGGPAQQQRGRGSRGSRGNRGGNVGGKRKADGYNQPDSKRRQTNNQQNWGSQPIA
QQPLQQGGDYSGNYGYNNDNQEFYQDTYGQQWK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43390	0.999	0.999	0.000	633	1.000	1.000	O43390.pdb.gz	HNRPR_HUMAN Heterogeneous nuclear ribonucleoprotein R OS=Homo sapiens OX=9606 GN=HNRNPR PE=1 SV=1
2	AFDB:Q8IN47	0.627	0.703	9.826E-63	563	0.434	0.488	Q8IN47.pdb.gz	Q8IN47_DROME Syncrip, isoform A OS=Drosophila melanogaster OX=7227 GN=Syp PE=1 SV=2
3	AFDB:Q9ASP6	0.293	0.359	3.448E-28	495	0.209	0.267	Q9ASP6.pdb.gz	HNRPQ_ARATH Heterogeneous nuclear ribonucleoprotein Q OS=Arabidopsis thaliana OX=3702 GN=LIF2 PE=1 SV=1
4	PDB:5vsuA	0.136	0.209	1.119E-15	387	0.081	0.132	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
5	AFDB:O43719	0.137	0.119	1.245E-13	755	0.148	0.125	O43719.pdb.gz	HTSF1_HUMAN HIV Tat-specific factor 1 OS=Homo sapiens OX=9606 GN=HTATSF1 PE=1 SV=1
6	AFDB:P92966	0.154	0.243	1.677E-13	356	0.139	0.247	P92966.pdb.gz	SRS41_ARATH Serine/arginine-rich splicing factor RS41 OS=Arabidopsis thaliana OX=3702 GN=RS41 PE=1 SV=2
7	AFDB:Q96T37	0.166	0.118	9.425E-13	977	0.169	0.110	Q96T37.pdb.gz	RBM15_HUMAN RNA-binding protein 15 OS=Homo sapiens OX=9606 GN=RBM15 PE=1 SV=2
8	AFDB:A0A0S2Z4Z0	0.118	0.112	4.992E-12	669	0.131	0.124	A0A0S2Z4Z0.pdb.gz	A0A0S2Z4Z0_HUMAN RNA binding motif protein 14 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=RBM14 PE=2 SV=1
9	AFDB:P92965	0.155	0.249	6.335E-12	350	0.128	0.231	P92965.pdb.gz	RS40_ARATH Serine/arginine-rich splicing factor RS40 OS=Arabidopsis thaliana OX=3702 GN=RS40 PE=1 SV=2
10	AFDB:O61646	0.114	0.138	4.796E-11	513	0.118	0.146	O61646.pdb.gz	O61646_DROME Splicing factor SRp54 OS=Drosophila melanogaster OX=7227 GN=Srp54 PE=2 SV=3
11	AFDB:Q8W4I9	0.130	0.092	1.040E-10	915	0.133	0.092	Q8W4I9.pdb.gz	AML1_ARATH Protein MEI2-like 1 OS=Arabidopsis thaliana OX=3702 GN=ML1 PE=1 SV=1
12	PDB:5lsbA	0.118	0.399	1.094E-10	176	0.066	0.239	5lsbA.pdb.gz
13	PDB:6r5kH	0.127	0.191	3.821E-10	394	0.114	0.183	6r5kH.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
14	PDB:7oqcF	0.129	0.290	4.568E-10	267	0.074	0.176	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
15	PDB:6y53o	0.116	0.422	5.462E-10	160	0.058	0.231	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
16	PDB:7evoD	0.119	0.369	1.072E-8	200	0.073	0.230	7evoD.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
17	PDB:6y5qq	0.104	0.352	1.444E-8	178	0.074	0.264	6y5qq.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
18	PDB:3lqvB	0.124	0.628	1.562E-7	115	0.044	0.243	3lqvB.pdb.gz	Branch Recognition by SF3b14
19	PDB:6ff7X	0.104	0.329	6.521E-7	171	0.065	0.240	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
20	PDB:7ohxo	0.106	0.546	8.955E-6	112	0.032	0.179	7ohxo.pdb.gz	Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6GJB1	0.0	967	532	0.755	0.898	A0A8I6GJB1_RAT Heterogeneous nuclear ribonucleoprotein R OS=Rattus norvegicus OX=10116 GN=Hnrnpr PE=1 SV=1
2	A2AW41	0.0	556	270	0.427	1.000	A2AW41_MOUSE Heterogeneous nuclear ribonucleoprotein R (Fragment) OS=Mus musculus OX=10090 GN=Hnrnpr PE=1 SV=1
3	F7B5B5	0.0	1077	531	0.836	0.996	F7B5B5_MOUSE Heterogeneous nuclear ribonucleoprotein R OS=Mus musculus OX=10090 GN=Hnrnpr PE=1 SV=1
4	O43390	0.0	1293	633	1.000	1.000	HNRPR_HUMAN Heterogeneous nuclear ribonucleoprotein R OS=Homo sapiens OX=9606 GN=HNRNPR PE=1 SV=1
5	O60506	0.0	895	623	0.787	0.799	HNRPQ_HUMAN Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens OX=9606 GN=SYNCRIP PE=1 SV=2
6	Q3U8W9	0.0	1284	632	0.994	0.995	Q3U8W9_MOUSE RRM domain-containing protein OS=Mus musculus OX=10090 GN=Hnrnpr PE=2 SV=1
7	Q3UKV5	0.0	1178	610	0.913	0.948	Q3UKV5_MOUSE RRM domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Hnrnpr PE=2 SV=1
8	Q3UMT8	0.0	1285	632	0.994	0.995	Q3UMT8_MOUSE RRM domain-containing protein OS=Mus musculus OX=10090 GN=Hnrnpr PE=2 SV=1
9	Q3UZI0	0.0	1179	604	0.913	0.957	Q3UZI0_MOUSE RRM domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Hnrnpr PE=2 SV=1
10	Q566E4	0.0	1286	632	0.994	0.995	Q566E4_RAT Heterogeneous nuclear ribonucleoprotein R OS=Rattus norvegicus OX=10116 GN=Hnrnpr PE=1 SV=1
11	Q59GL1	0.0	748	534	0.637	0.755	Q59GL1_HUMAN Synaptotagmin binding, cytoplasmic RNA interacting protein variant (Fragment) OS=Homo sapiens OX=9606 PE=2 SV=1
12	Q7TMK9	0.0	896	623	0.787	0.799	HNRPQ_MOUSE Heterogeneous nuclear ribonucleoprotein Q OS=Mus musculus OX=10090 GN=Syncrip PE=1 SV=2
13	Q7TP47	0.0	677	533	0.616	0.732	HNRPQ_RAT Heterogeneous nuclear ribonucleoprotein Q OS=Rattus norvegicus OX=10116 GN=Syncrip PE=2 SV=1
14	Q8BL32	0.0	610	307	0.482	0.993	Q8BL32_MOUSE RRM domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Hnrnpr PE=2 SV=1
15	Q8VHM5	0.0	1286	632	0.995	0.997	Q8VHM5_MOUSE Heterogeneous nuclear ribonucleoprotein R OS=Mus musculus OX=10090 GN=Hnrnpr PE=1 SV=1
16	Q99KG1	0.0	1179	601	0.913	0.962	Q99KG1_MOUSE Hnrpr protein (Fragment) OS=Mus musculus OX=10090 GN=Hnrnpr PE=2 SV=1
17	Q9CT37	0.0	739	381	0.569	0.945	Q9CT37_MOUSE RRM domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Hnrnpr PE=2 SV=3
18	A0A0B4KGF9	2.04e-178	523	665	0.431	0.411	A0A0B4KGF9_DROME Syncrip, isoform N OS=Drosophila melanogaster OX=7227 GN=Syp PE=1 SV=1
19	Q9VDI8	2.66e-178	524	707	0.431	0.386	Q9VDI8_DROME Syncrip, isoform D OS=Drosophila melanogaster OX=7227 GN=Syp PE=1 SV=2
20	A0A0B4KGK8	1.03e-177	518	569	0.398	0.443	A0A0B4KGK8_DROME Syncrip, isoform R OS=Drosophila melanogaster OX=7227 GN=Syp PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18360 hnRNP_Q_AcD	2.1e-28	109.6	Heterogeneous nuclear ribonucleoprotein Q acidic domain
2	PF14605 Nup35_RRM_2	2.1e+02	13.3	Nup53/35/40-type RNA recognition motif
3	PF00076 RRM_1	3.7e-39	143.7	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
4	PF13893 RRM_5	0.087	23.9	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
5	PF16367 RRM_7	5.2e-07	41.0	RNA recognition motif
6	PF16842 RRM_occluded	6.6	18.0	Occluded RNA-recognition motif
7	PF15407 Spo7_2_N	5.1e+02	11.7	Sporulation protein family 7

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010354075.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010366377.1	0.976	glutamyl-prolyl-tRNA synthetase
2	61622.XP_010351586.1	0.974	Heterogeneous nuclear ribonucleoprotein U
3	61622.XP_010379242.1	0.971	Heterogeneous nuclear ribonucleoprotein L isoform X1
4	61622.XP_010357653.1	0.957	Heterogeneous nuclear ribonucleoprotein M-like
5	61622.XP_010387133.1	0.957	Heterogeneous nuclear ribonucleoprotein M
6	61622.XP_010354836.1	0.954	Heterogeneous nuclear ribonucleoprotein A2/B1
7	61622.XP_010379281.1	0.954	Heterogeneous nuclear ribonucleoprotein H isoform X1
8	61622.XP_010371222.1	0.951	Serine and arginine rich splicing factor 1
9	61622.XP_010374447.1	0.950	Heterogeneous nuclear ribonucleoprotein F
10	61622.XP_010352737.1	0.949	Sjogren syndrome antigen B
11	61622.XP_010369868.1	0.948	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 3 bases in 2 codons
12	61622.XP_010382313.1	0.948	Heterogeneous nuclear ribonucleoprotein K isoform X1
13	61622.XP_010367227.1	0.945	DExH-box helicase 9
14	61622.XP_010373232.1	0.937	Polypyrimidine tract-binding protein 1 isoform X1
15	61622.XP_010363086.1	0.934	Interleukin enhancer-binding factor 2
16	61622.XP_010354187.1	0.932	Heterogeneous nuclear ribonucleoprotein C (C1/C2)
17	61622.XP_010368692.1	0.932	Heterogeneous nuclear ribonucleoprotein C-like
18	61622.XP_010386367.1	0.929	Heterogeneous nuclear ribonucleoprotein A0
19	61622.XP_010382274.1	0.921	Synaptotagmin binding cytoplasmic RNA interacting protein
20	61622.XP_010374901.1	0.917	Transformer 2 beta homolog (Drosophila)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003723	1.000	RNA binding
GO:0005515	0.999	protein binding
GO:0003729	0.991	mRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0010608	0.980	post-transcriptional regulation of gene expression
GO:2000112	0.979	regulation of cellular macromolecule biosynthetic process
GO:0071704	0.978	organic substance metabolic process
GO:0044238	0.977	primary metabolic process
GO:0034248	0.977	regulation of amide metabolic process
GO:0044237	0.975	cellular metabolic process
GO:0051252	0.975	regulation of RNA metabolic process
GO:0006417	0.968	regulation of translation
GO:0048519	0.966	negative regulation of biological process
GO:1903311	0.957	regulation of mRNA metabolic process
GO:0061013	0.949	regulation of mRNA catabolic process
GO:0006807	0.947	nitrogen compound metabolic process
GO:0048523	0.945	negative regulation of cellular process
GO:0006397	0.941	mRNA processing
GO:0043487	0.923	regulation of RNA stability
GO:0000377	0.918	RNA splicing, via transesterification reactions with bulged adenosine as nucleophile
GO:0043488	0.907	regulation of mRNA stability
GO:0009892	0.858	negative regulation of metabolic process
GO:1903313	0.856	positive regulation of mRNA metabolic process
GO:0051172	0.847	negative regulation of nitrogen compound metabolic process
GO:2000113	0.823	negative regulation of cellular macromolecule biosynthetic process
GO:0000398	0.811	mRNA splicing, via spliceosome
GO:0017148	0.766	negative regulation of translation
GO:0061014	0.719	positive regulation of mRNA catabolic process
GO:0050896	0.540	response to stimulus
GO:0032502	0.487	developmental process
GO:0032501	0.456	multicellular organismal process
GO:0010628	0.364	positive regulation of gene expression
GO:0071840	0.343	cellular component organization or biogenesis
GO:0048856	0.314	anatomical structure development
GO:0030154	0.308	cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0032991	0.934	protein-containing complex
GO:0005737	0.850	cytoplasm
GO:0070013	0.433	intracellular organelle lumen
GO:0031981	0.408	nuclear lumen
GO:0140513	0.400	nuclear protein-containing complex
GO:0071013	0.393	catalytic step 2 spliceosome
GO:0043232	0.306	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]