StarFunc result for job id O43396

User Input

>input (289 residues)
MVGVKPVGSDPDFQPELSGAGSRLAVVKFTMRGCGPCLRIAPAFSSMSNKYPQAVFLEVD
VHQCQGTAATNNISATPTFLFFRNKVRIDQYQGADAVGLEEKIKQHLENDPGSNEDTDIP
KGYMDLMPFINKAGCECLNESDEHGFDNCLRKDTTFLESDCDEQLLITVAFNQPVKLYSM
KFQGPDNGQGPKYVKIFINLPRSMDFEEAERSEPTQALELTEDDIKEDGIVPLRYVKFQN
VNSVTIFVQSNQGEEETTRISYFTFIGTPVQATNMNDFKRVVGKKGESH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43396	1.000	1.000	3.759E-67	289	1.000	1.000	O43396.pdb.gz	TXNL1_HUMAN Thioredoxin-like protein 1 OS=Homo sapiens OX=9606 GN=TXNL1 PE=1 SV=3
2	AFDB:Q9USR1	0.555	0.553	1.541E-32	290	0.356	0.355	Q9USR1.pdb.gz	TXL1_SCHPO Thioredoxin-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=txl1 PE=4 SV=1
3	AFDB:Q9SQZ9	0.523	0.844	2.774E-20	176	0.266	0.438	Q9SQZ9.pdb.gz	PITH1_ARATH PITH domain-containing protein At3g04780 OS=Arabidopsis thaliana OX=3702 GN=At3g04780 PE=1 SV=2
4	PDB:1xoyA	0.488	0.847	3.485E-16	161	0.232	0.416	1xoyA.pdb.gz
5	AFDB:Q8BWR2	0.466	0.630	2.081E-14	211	0.163	0.223	Q8BWR2.pdb.gz	PITH1_MOUSE PITH domain-containing protein 1 OS=Mus musculus OX=10090 GN=Pithd1 PE=1 SV=1
6	PDB:1xwaA	0.343	0.874	7.981E-12	111	0.131	0.342	1xwaA.pdb.gz
7	AFDB:P10639	0.349	0.949	9.479E-12	105	0.145	0.400	P10639.pdb.gz	THIO_MOUSE Thioredoxin OS=Mus musculus OX=10090 GN=Txn PE=1 SV=3
8	AFDB:H9ZYJ2	0.349	0.946	1.139E-11	105	0.145	0.400	H9ZYJ2.pdb.gz	H9ZYJ2_HUMAN Thioredoxin OS=Homo sapiens OX=9606 GN=TXN PE=2 SV=1
9	AFDB:Q9P7A1	0.445	0.608	1.287E-11	207	0.138	0.193	Q9P7A1.pdb.gz	PITH1_SCHPO PITH domain-containing protein P35G2.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBP35G2.02 PE=3 SV=1
10	AFDB:Q5XHX6	0.353	0.187	1.859E-11	550	0.118	0.062	Q5XHX6.pdb.gz	TXND2_RAT Thioredoxin domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Txndc2 PE=1 SV=2
11	AFDB:Q9V429	0.344	0.919	4.119E-11	106	0.131	0.358	Q9V429.pdb.gz	THIO2_DROME Thioredoxin-2 OS=Drosophila melanogaster OX=7227 GN=Trx-2 PE=1 SV=3
12	PDB:4pufC	0.346	0.870	5.007E-11	112	0.145	0.375	4pufC.pdb.gz
13	AFDB:Q86VQ3	0.349	0.183	7.596E-11	553	0.135	0.071	Q86VQ3.pdb.gz	TXND2_HUMAN Thioredoxin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=TXNDC2 PE=1 SV=4
14	PDB:4j56E	0.345	0.927	1.333E-10	105	0.118	0.324	4j56E.pdb.gz	Crystal Structure of the Plasmodium falciparum Thioredoxin Reductase-Thioredoxin Complex.
15	PDB:6z7oA	0.351	0.905	3.339E-10	110	0.100	0.264	6z7oA.pdb.gz	Structures of the germline-specific Deadhead and thioredoxin T proteins from Drosophila melanogaster reveal unique features among thioredoxins.
16	PDB:3f3qA	0.335	0.866	3.774E-10	109	0.118	0.312	3f3qA.pdb.gz	Structural and kinetic analysis of Saccharomyces cerevisiae thioredoxin Trx1: implications for the catalytic mechanism of GSSG reduced by the thioredoxin system
17	PDB:2fa4A	0.340	0.925	1.640E-9	104	0.097	0.269	2fa4A.pdb.gz
18	PDB:1r26A	0.348	0.862	7.127E-9	113	0.087	0.221	1r26A.pdb.gz
19	PDB:6zmuA	0.333	0.866	9.104E-9	107	0.100	0.271	6zmuA.pdb.gz
20	PDB:1xflA	0.341	0.816	1.486E-8	114	0.125	0.316	1xflA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	K7ER96	0.0	575	281	0.955	0.982	K7ER96_HUMAN Thioredoxin like 1 (Fragment) OS=Homo sapiens OX=9606 GN=TXNL1 PE=1 SV=1
2	O43396	0.0	601	289	1.000	1.000	TXNL1_HUMAN Thioredoxin-like protein 1 OS=Homo sapiens OX=9606 GN=TXNL1 PE=1 SV=3
3	V9HW51	0.0	601	289	1.000	1.000	V9HW51_HUMAN Epididymis secretory protein Li 114 OS=Homo sapiens OX=9606 GN=HEL-S-114 PE=2 SV=1
4	Q9USR1	7.29e-51	171	290	0.349	0.348	TXL1_SCHPO Thioredoxin-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=txl1 PE=4 SV=1
5	Q9SQZ9	7.31e-38	134	176	0.256	0.420	PITH1_ARATH PITH domain-containing protein At3g04780 OS=Arabidopsis thaliana OX=3702 GN=At3g04780 PE=1 SV=2
6	P10639	1.79e-21	89.0	105	0.145	0.400	THIO_MOUSE Thioredoxin OS=Mus musculus OX=10090 GN=Txn PE=1 SV=3
7	H9ZYJ2	2.87e-21	88.2	105	0.145	0.400	H9ZYJ2_HUMAN Thioredoxin OS=Homo sapiens OX=9606 GN=TXN PE=2 SV=1
8	P10599	2.87e-21	88.2	105	0.145	0.400	THIO_HUMAN Thioredoxin OS=Homo sapiens OX=9606 GN=TXN PE=1 SV=3
9	P11232	5.73e-21	87.4	105	0.145	0.400	THIO_RAT Thioredoxin OS=Rattus norvegicus OX=10116 GN=Txn PE=1 SV=2
10	Q9DGI3	5.15e-18	79.7	107	0.131	0.355	THIO_ICTPU Thioredoxin OS=Ictalurus punctatus OX=7998 GN=txn PE=3 SV=1
11	Q9V429	8.41e-18	79.0	106	0.131	0.358	THIO2_DROME Thioredoxin-2 OS=Drosophila melanogaster OX=7227 GN=Trx-2 PE=1 SV=3
12	Q8VWG7	1.68e-17	84.0	380	0.125	0.095	TDX_ARATH TPR repeat-containing thioredoxin TDX OS=Arabidopsis thaliana OX=3702 GN=TDX PE=1 SV=1
13	Q9TW67	3.25e-16	80.9	606	0.149	0.071	NGLY1_CAEEL Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase OS=Caenorhabditis elegans OX=6239 GN=png-1 PE=1 SV=1
14	Q69AB1	8.28e-16	74.3	127	0.156	0.354	TXND8_RAT Thioredoxin domain-containing protein 8 OS=Rattus norvegicus OX=10116 GN=Txndc8 PE=2 SV=1
15	Q0D840	9.74e-16	73.9	122	0.121	0.287	TRXH1_ORYSJ Thioredoxin H1 OS=Oryza sativa subsp. japonica OX=39947 GN=TRXH PE=1 SV=1
16	O14463	1.39e-15	73.2	103	0.121	0.340	TRX1_SCHPO Thioredoxin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=trx1 PE=3 SV=3
17	P29448	3.39e-14	69.7	114	0.118	0.298	TRXH1_ARATH Thioredoxin H1 OS=Arabidopsis thaliana OX=3702 GN=TRX1 PE=1 SV=1
18	Q7KQL8	8.40e-14	68.2	104	0.121	0.337	THIO1_PLAF7 Thioredoxin 1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=TRX1 PE=1 SV=1
19	P22217	2.43e-13	67.0	103	0.111	0.311	TRX1_YEAST Thioredoxin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TRX1 PE=1 SV=3
20	Q39241	3.94e-13	67.0	118	0.107	0.263	TRXH5_ARATH Thioredoxin H5 OS=Arabidopsis thaliana OX=3702 GN=TRX5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04756 OST3_OST6	8.7	17.2	OST3 / OST6 family, transporter family
2	PF06201 PITH	1.2e-37	140.9	PITH domain
3	PF00085 Thioredoxin	4.7e-13	60.4	Thioredoxin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000009780

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000002428	0.987	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 14
2	61853.ENSNLEP00000019091	0.982	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 13
3	61853.ENSNLEP00000020685	0.971	Proteasome (prosome, macropain) 26S subunit, ATPase, 1
4	61853.ENSNLEP00000014388	0.961	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 6
5	61853.ENSNLEP00000015936	0.951	Proteasome (prosome, macropain) subunit, alpha type, 3
6	61853.ENSNLEP00000020499	0.930	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 8
7	61853.ENSNLEP00000004474	0.929	Proteasome (prosome, macropain) subunit, alpha type, 6
8	61853.ENSNLEP00000017781	0.929	Proteasome (prosome, macropain) 26S subunit, ATPase, 3
9	61853.ENSNLEP00000001750	0.925	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 3
10	61853.ENSNLEP00000000693	0.917	Proteasome (prosome, macropain) subunit, beta type, 3
11	61853.ENSNLEP00000001603	0.892	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 12
12	61853.ENSNLEP00000006801	0.885	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 7
13	61853.ENSNLEP00000012370	0.878	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 4
14	61853.ENSNLEP00000021123	0.823	Proteasome (prosome, macropain) subunit, beta type, 6
15	61853.ENSNLEP00000003464	0.816	Proteasome (prosome, macropain) subunit, alpha type, 5
16	61853.ENSNLEP00000017599	0.790	BRCA1/BRCA2-containing complex, subunit 3
17	61853.ENSNLEP00000017962	0.790	Myb-like, SWIRM and MPN domains 1
18	61853.ENSNLEP00000023703	0.777	Uncharacterized protein
19	61853.ENSNLEP00000024216	0.777	Uncharacterized protein
20	61853.ENSNLEP00000012443	0.768	Proteasome (prosome, macropain) subunit, beta type, 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0015036	1.000	disulfide oxidoreductase activity
GO:0005515	0.985	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0050789	0.976	regulation of biological process
GO:0050794	0.912	regulation of cellular process
GO:0008152	0.819	metabolic process
GO:0071704	0.790	organic substance metabolic process
GO:0006807	0.707	nitrogen compound metabolic process
GO:0019222	0.697	regulation of metabolic process
GO:0044238	0.683	primary metabolic process
GO:0043170	0.554	macromolecule metabolic process
GO:0080090	0.524	regulation of primary metabolic process
GO:0051171	0.524	regulation of nitrogen compound metabolic process
GO:0048518	0.495	positive regulation of biological process
GO:0044237	0.495	cellular metabolic process
GO:0050896	0.472	response to stimulus
GO:0060255	0.452	regulation of macromolecule metabolic process
GO:1901564	0.416	organonitrogen compound metabolic process
GO:0019538	0.398	protein metabolic process
GO:0031323	0.317	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005575	1.000	cellular_component
GO:0005829	0.990	cytosol
GO:0032991	0.516	protein-containing complex
GO:0005654	0.434	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.8.-.-	1.000	Acting on a sulfur group of donors.

[back to server]