StarFunc result for job id O43424

User Input

>input (1007 residues)
MEVFPFLLVLSVWWSRTWDSANADSIIHIGAIFDESAKKDDEVFRTAVGDLNQNEEILQT
EKITFSVTFVDGNNPFQAVQEACELMNQGILALVSSIGCTSAGSLQSLADAMHIPHLFIQ
RSTAGTPRSGCGLTRSNRNDDYTLSVRPPVYLHDVILRVVTEYAWQKFIIFYDSEYDIRG
IQEFLDKVSQQGMDVALQKVENNINKMITTLFDTMRIEELNRYRDTLRRAILVMNPATAK
SFITEVVETNLVAFDCHWIIINEEINDVDVQELVRRSIGRLTIIRQTFPVPQNISQRCFR
GNHRISSTLCDPKDPFAQNMEISNLYIYDTVLLLANAFHKKLEDRKWHSMASLSCIRKNS
KPWQGGRSMLETIKKGGVSGLTGELEFGENGGNPNVHFEILGTNYGEELGRGVRKLGCWN
PVTGLNGSLTDKKLENNMRGVVLRVVTVLEEPFVMVSENVLGKPKKYQGFSIDVLDALSN
YLGFNYEIYVAPDHKYGSPQEDGTWNGLVGELVFKRADIGISALTITPDRENVVDFTTRY
MDYSVGVLLRRAEKTVDMFACLAPFDLSLWACIAGTVLLVGLLVYLLNWLNPPRLQMGSM
TSTTLYNSMWFVYGSFVQQGGEVPYTTLATRMMMGAWWLFALIVISSYTANLAAFLTITR
IESSIQSLQDLSKQTEIPYGTVLDSAVYEHVRMKGLNPFERDSMYSQMWRMINRSNGSEN
NVLESQAGIQKVKYGNYAFVWDAAVLEYVAINDPDCSFYTIGNTVADRGYGIALQHGSPY
RDVFSQRILELQQNGDMDILKHKWWPKNGQCDLYSSVDTKQKGGALDIKSFAGVFCILAA
GIVLSCFIAMLETWWNKRKGSRVPSKEDDKEIDLEHLHRRVNSLCTDDDSPHKQFSTSSI
DLTPLDIDTLPTRQALEQISDFRNTHITTTTFIPEQIQTLSRTLSAKAASGFTFGNVPEH
RTGPFRHRAPNGGFFRSPIKTMSSIPYQPTPTLGLNLGNDPDRGTSI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43424	1.000	1.000	0.000	1007	1.000	1.000	O43424.pdb.gz	GRID2_HUMAN Glutamate receptor ionotropic, delta-2 OS=Homo sapiens OX=9606 GN=GRID2 PE=1 SV=2
2	AFDB:Q61627	0.790	0.788	0.000	1009	0.561	0.560	Q61627.pdb.gz	GRID1_MOUSE Glutamate receptor ionotropic, delta-1 OS=Mus musculus OX=10090 GN=Grid1 PE=1 SV=2
3	AFDB:Q9VDH5	0.561	0.641	5.584E-66	853	0.243	0.287	Q9VDH5.pdb.gz	Q9VDH5_DROME Kainate-type ionotropic glutamate receptor subunit 1D OS=Drosophila melanogaster OX=7227 GN=KaiR1D PE=1 SV=1
4	PDB:7rz4A	0.450	0.456	3.431E-63	993	0.227	0.231	7rz4A.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
5	PDB:7ocaA	0.427	0.531	3.283E-61	775	0.217	0.283	7ocaA.pdb.gz	Gating and modulation of a hetero-octameric AMPA glutamate receptor.
6	PDB:7rzaA	0.442	0.452	5.151E-59	981	0.230	0.236	7rzaA.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
7	PDB:5idfB	0.361	0.462	1.823E-58	734	0.214	0.293	5idfB.pdb.gz
8	PDB:5kbtA	0.450	0.462	5.471E-58	973	0.222	0.230	5kbtA.pdb.gz	Elucidation of AMPA receptor-stargazin complexes by cryo-electron microscopy.
9	PDB:4u1xC	0.469	0.594	8.125E-56	755	0.215	0.287	4u1xC.pdb.gz	Structure and Dynamics of AMPA Receptor GluA2 in Resting, Pre-Open, and Desensitized States.
10	PDB:4u1wA	0.505	0.661	1.069E-55	731	0.205	0.282	4u1wA.pdb.gz	Structure and Dynamics of AMPA Receptor GluA2 in Resting, Pre-Open, and Desensitized States.
11	PDB:5weoA	0.445	0.452	1.069E-55	988	0.226	0.231	5weoA.pdb.gz	Channel opening and gating mechanism in AMPA-subtype glutamate receptors.
12	AFDB:Q21415	0.406	0.463	1.079E-55	836	0.206	0.248	Q21415.pdb.gz	GLR3_CAEEL Glutamate receptor ionotropic, kainate glr-3 OS=Caenorhabditis elegans OX=6239 GN=glr-3 PE=1 SV=3
13	AFDB:E9NA96	0.398	0.416	1.692E-53	947	0.190	0.202	E9NA96.pdb.gz	IR25A_DROME Ionotropic receptor 25a OS=Drosophila melanogaster OX=7227 GN=Ir25a PE=1 SV=1
14	PDB:4uqqA	0.422	0.575	4.270E-53	693	0.206	0.299	4uqqA.pdb.gz	Structural Mechanism of Glutamate Receptor Activation and Desensitization
15	PDB:7vm2B	0.333	0.438	4.063E-52	736	0.217	0.298	7vm2B.pdb.gz
16	AFDB:A2AIR5	0.416	0.379	1.114E-49	1135	0.204	0.181	A2AIR5.pdb.gz	NMD3A_MOUSE Glutamate receptor ionotropic, NMDA 3A OS=Mus musculus OX=10090 GN=Grin3a PE=1 SV=1
17	AFDB:Q91ZU9	0.372	0.373	1.729E-49	1003	0.187	0.187	Q91ZU9.pdb.gz	NMD3B_MOUSE Glutamate receptor ionotropic, NMDA 3B OS=Mus musculus OX=10090 GN=Grin3b PE=1 SV=1
18	AFDB:Q8TCU5	0.368	0.338	6.119E-49	1115	0.192	0.173	Q8TCU5.pdb.gz	NMD3A_HUMAN Glutamate receptor ionotropic, NMDA 3A OS=Homo sapiens OX=9606 GN=GRIN3A PE=1 SV=2
19	AFDB:Q9V9T2	0.374	0.575	3.845E-23	603	0.095	0.159	Q9V9T2.pdb.gz	Q9V9T2_DROME Ionotropic receptor 100a OS=Drosophila melanogaster OX=7227 GN=Ir100a PE=4 SV=2
20	AFDB:A8JNV9	0.360	0.507	1.226E-21	646	0.095	0.149	A8JNV9.pdb.gz	A8JNV9_DROME Ionotropic receptor 76a, isoform E OS=Drosophila melanogaster OX=7227 GN=Ir76a PE=4 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43424	0.0	2098	1007	1.000	1.000	GRID2_HUMAN Glutamate receptor ionotropic, delta-2 OS=Homo sapiens OX=9606 GN=GRID2 PE=1 SV=2
2	Q61625	0.0	2054	1007	0.976	0.976	GRID2_MOUSE Glutamate receptor ionotropic, delta-2 OS=Mus musculus OX=10090 GN=Grid2 PE=1 SV=1
3	Q61627	0.0	1198	1009	0.565	0.564	GRID1_MOUSE Glutamate receptor ionotropic, delta-1 OS=Mus musculus OX=10090 GN=Grid1 PE=1 SV=2
4	Q62640	0.0	1197	1009	0.564	0.563	GRID1_RAT Glutamate receptor ionotropic, delta-1 OS=Rattus norvegicus OX=10116 GN=Grid1 PE=1 SV=1
5	Q63226	0.0	2058	1007	0.977	0.977	GRID2_RAT Glutamate receptor ionotropic, delta-2 OS=Rattus norvegicus OX=10116 GN=Grid2 PE=1 SV=2
6	Q9ULK0	0.0	1195	1009	0.563	0.562	GRID1_HUMAN Glutamate receptor ionotropic, delta-1 OS=Homo sapiens OX=9606 GN=GRID1 PE=2 SV=2
7	H7BYG7	4.82e-111	366	871	0.257	0.297	H7BYG7_HUMAN Glutamate receptor OS=Homo sapiens OX=9606 GN=GRIK1 PE=1 SV=1
8	E7ENK3	5.45e-111	368	949	0.259	0.275	E7ENK3_HUMAN Glutamate receptor OS=Homo sapiens OX=9606 GN=GRIK1 PE=1 SV=1
9	F7AGW3	5.45e-111	368	949	0.259	0.275	F7AGW3_MACMU Glutamate receptor OS=Macaca mulatta OX=9544 GN=GRIK1 PE=3 SV=2
10	P39086	1.07e-110	366	918	0.257	0.282	GRIK1_HUMAN Glutamate receptor ionotropic, kainate 1 OS=Homo sapiens OX=9606 GN=GRIK1 PE=1 SV=1
11	E9PD61	1.32e-110	366	920	0.257	0.282	E9PD61_HUMAN Glutamate receptor OS=Homo sapiens OX=9606 GN=GRIK1 PE=1 SV=1
12	P42260	6.70e-110	364	908	0.256	0.284	GRIK2_RAT Glutamate receptor ionotropic, kainate 2 OS=Rattus norvegicus OX=10116 GN=Grik2 PE=1 SV=2
13	Q13002	7.50e-110	364	908	0.256	0.284	GRIK2_HUMAN Glutamate receptor ionotropic, kainate 2 OS=Homo sapiens OX=9606 GN=GRIK2 PE=1 SV=1
14	P39087	1.10e-109	363	908	0.256	0.284	GRIK2_MOUSE Glutamate receptor ionotropic, kainate 2 OS=Mus musculus OX=10090 GN=Grik2 PE=1 SV=4
15	Q38PU3	4.00e-109	362	908	0.254	0.282	GRIK2_MACFA Glutamate receptor ionotropic, kainate 2 OS=Macaca fascicularis OX=9541 GN=GRIK2 PE=2 SV=1
16	P22756	5.74e-107	357	949	0.254	0.270	GRIK1_RAT Glutamate receptor ionotropic, kainate 1 OS=Rattus norvegicus OX=10116 GN=Grik1 PE=1 SV=3
17	P42261	8.13e-107	355	906	0.233	0.259	GRIA1_HUMAN Glutamate receptor 1 OS=Homo sapiens OX=9606 GN=GRIA1 PE=1 SV=2
18	P42264	2.19e-106	355	919	0.255	0.280	GRIK3_RAT Glutamate receptor ionotropic, kainate 3 OS=Rattus norvegicus OX=10116 GN=Grik3 PE=1 SV=1
19	Q38PU2	4.81e-106	354	919	0.256	0.281	GRIK3_MACFA Glutamate receptor ionotropic, kainate 3 OS=Macaca fascicularis OX=9541 GN=GRIK3 PE=2 SV=1
20	Q13003	1.39e-105	352	919	0.256	0.281	GRIK3_HUMAN Glutamate receptor ionotropic, kainate 3 OS=Homo sapiens OX=9606 GN=GRIK3 PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01094 ANF_receptor	7.8e-46	168.5	Receptor family ligand binding region
2	PF06771 Desmo_N	1.2e+02	14.5	Viral Desmoplakin N-terminus
3	PF20485 DUF6724	2.2e+02	13.1	Family of unknown function (DUF6724)
4	PF00060 Lig_chan	1.8e-38	143.2	Ligand-gated ion channel
5	PF10613 Lig_chan-Glu_bd	5.9e-32	121.6	Ligated ion channel L-glutamate- and glycine-binding site
6	PF00075 RNase_H	5.6e+02	12.1	RNase H
7	PF00497 SBP_bac_3	5.2e-17	73.6	Bacterial extracellular solute-binding proteins, family 3

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000282020

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000219197	0.995	Cerebellin-1
2	9606.ENSP00000397351	0.986	Delphilin
3	9606.ENSP00000265459	0.971	Neurexin-2
4	9606.ENSP00000355231	0.895	Beclin-1
5	9606.ENSP00000469689	0.846	SH3 and multiple ankyrin repeat domains protein 2
6	9606.ENSP00000365272	0.816	Disks large homolog 2
7	9606.ENSP00000385142	0.809	Neurexin-1
8	9606.ENSP00000451648	0.806	Neurexin-3
9	9606.ENSP00000267406	0.800	Cerebellin-3
10	9606.ENSP00000300105	0.800	Voltage-dependent calcium channel gamma-2 subunit
11	9606.ENSP00000477455	0.789	Glutamate receptor ionotropic, NMDA 2B
12	9606.ENSP00000269503	0.771	Cerebellin-2
13	9606.ENSP00000263708	0.762	Tyrosine-protein phosphatase non-receptor type 4
14	9606.ENSP00000354896	0.760	Metabotropic glutamate receptor 1
15	9606.ENSP00000428994	0.760	Glutamate receptor 1
16	9606.ENSP00000296526	0.757	Glutamate receptor 2
17	9606.ENSP00000375647	0.751	Voltage-dependent calcium channel gamma-7 subunit
18	9606.ENSP00000379818	0.749	Glutamate receptor ionotropic, NMDA 2A
19	9606.ENSP00000262895	0.743	Glutamate receptor ionotropic, kainate 5
20	9606.ENSP00000382428	0.743	Disks large homolog 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008066	0.999	glutamate receptor activity
GO:0042802	0.995	identical protein binding
GO:0015075	0.995	monoatomic ion transmembrane transporter activity
GO:0005216	0.993	monoatomic ion channel activity
GO:0030165	0.985	PDZ domain binding
GO:0015276	0.975	ligand-gated monoatomic ion channel activity
GO:0022824	0.911	transmitter-gated monoatomic ion channel activity
GO:0004970	0.880	ionotropic glutamate receptor activity
GO:0015318	0.860	inorganic molecular entity transmembrane transporter activity
GO:0022890	0.827	inorganic cation transmembrane transporter activity
GO:0097110	0.803	scaffold protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0050803	0.991	regulation of synapse structure or activity
GO:0009987	0.988	cellular process
GO:1901888	0.978	regulation of cell junction assembly
GO:0050807	0.967	regulation of synapse organization
GO:0051963	0.925	regulation of synapse assembly
GO:0007154	0.883	cell communication
GO:0050896	0.847	response to stimulus
GO:0032501	0.829	multicellular organismal process
GO:0023052	0.780	signaling
GO:0051716	0.710	cellular response to stimulus
GO:0007165	0.597	signal transduction
GO:0007166	0.375	cell surface receptor signaling pathway
GO:0099537	0.370	trans-synaptic signaling
GO:0048856	0.358	anatomical structure development
GO:0071840	0.344	cellular component organization or biogenesis
GO:0007275	0.341	multicellular organism development
GO:0023051	0.339	regulation of signaling
GO:0010646	0.338	regulation of cell communication
GO:0048518	0.319	positive regulation of biological process
GO:0048522	0.304	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043226	0.998	organelle
GO:0030054	0.985	cell junction
GO:0032991	0.980	protein-containing complex
GO:0097060	0.959	synaptic membrane
GO:0098794	0.947	postsynapse
GO:0045211	0.942	postsynaptic membrane
GO:0099572	0.925	postsynaptic specialization
GO:0014069	0.909	postsynaptic density
GO:0043227	0.907	membrane-bounded organelle
GO:0098839	0.827	postsynaptic density membrane
GO:0098978	0.805	glutamatergic synapse
GO:0060076	0.753	excitatory synapse
GO:0043231	0.730	intracellular membrane-bounded organelle
GO:0098688	0.700	parallel fiber to Purkinje cell synapse
GO:0031982	0.560	vesicle
GO:0043235	0.517	receptor complex
GO:0034702	0.515	ion channel complex
GO:0098797	0.513	plasma membrane protein complex
GO:0008328	0.485	ionotropic glutamate receptor complex
GO:0005737	0.406	cytoplasm
GO:0043005	0.360	neuron projection
GO:0030425	0.351	dendrite

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]