StarFunc result for job id O43426

User Input

>input (1573 residues)
MAFSKGFRIYHKLDPPPFSLIVETRHKEECLMFESGAVAVLSSAEKEAIKGTYSKVLDAY
GLLGVLRLNLGDTMLHYLVLVTGCMSVGKIQESEVFRVTSTEFISLRIDSSDEDRISEVR
KVLNSGNFYFAWSASGISLDLSLNAHRSMQEQTTDNRFFWNQSLHLHLKHYGVNCDDWLL
RLMCGGVEIRTIYAAHKQAKACLISRLSCERAGTRFNVRGTNDDGHVANFVETEQVVYLD
DSVSSFIQIRGSVPLFWEQPGLQVGSHRVRMSRGFEANAPAFDRHFRTLKNLYGKQIIVN
LLGSKEGEHMLSKAFQSHLKASEHAADIQMVNFDYHQMVKGGKAEKLHSVLKPQVQKFLD
YGFFYFNGSEVQRCQSGTVRTNCLDCLDRTNSVQAFLGLEMLAKQLEALGLAEKPQLVTR
FQEVFRSMWSVNGDSISKIYAGTGALEGKAKLKDGARSVTRTIQNNFFDSSKQEAIDVLL
LGNTLNSDLADKARALLTTGSLRVSEQTLQSASSKVLKSMCENFYKYSKPKKIRVCVGTW
NVNGGKQFRSIAFKNQTLTDWLLDAPKLAGIQEFQDKRSKPTDIFAIGFEEMVELNAGNI
VSASTTNQKLWAVELQKTISRDNKYVLLASEQLVGVCLFVFIRPQHAPFIRDVAVDTVKT
GMGGATGNKGAVAIRMLFHTTSLCFVCSHFAAGQSQVKERNEDFIEIARKLSFPMGRMLF
SHDYVFWCGDFNYRIDLPNEEVKELIRQQNWDSLIAGDQLINQKNAGQVFRGFLEGKVTF
APTYKYDLFSDDYDTSEKCRTPAWTDRVLWRRRKWPFDRSAEDLDLLNASFQDESKILYT
WTPGTLLHYGRAELKTSDHRPVVALIDIDIFEVEAEERQNIYKEVIAVQGPPDGTVLVSI
KSSLPENNFFDDALIDELLQQFASFGEVILIRFVEDKMWVTFLEGSSALNVLSLNGKELL
NRTITIALKSPDWIKNLEEEMSLEKISIALPSSTSSTLLGEDAEVAADFDMEGDVDDYSA
EVEELLPQHLQPSSSSGLGTSPSSSPRTSPCQSPTISEGPVPSLPIRPSRAPSRTPGPPS
AQSSPIDAQPATPLPQKDPAQPLEPKRPPPPRPVAPPTRPAPPQRPPPPSGARSPAPTRK
EFGGIGAPPSPGVARREMEAPKSPGTTRKDNIGRSQPSPQAGLAGPGPAGYSTARPTIPP
RAGVISAPQSHARASAGRLTPESQSKTSETSKGSTFLPEPLKPQAAFPPQSSLPPPAQRL
QEPLVPVAAPMPQSGPQPNLETPPQPPPRSRSSHSLPSEASSQPQVKTNGISDGKRESPL
KIDPFEDLSFNLLAVSKAQLSVQTSPVPTPDPKRLIQLPSATQSNVLSSVSCMPTMPPIP
ARSQSQENMRSSPNPFITGLTRTNPFSDRTAAPGNPFRAKSEESEATSWFSKEEPVTISP
FPSLQPLGHNKSRASSSLDGFKDSFDLQGQSTLKISNPKGWVTFEEEEDFGVKGKSKSAC
SDLLGNQPSSFSGSNLTLNDDWNKGTNVSFCVLPSRRPPPPPVPLLPPGTSPPVDPFTTL
ASKASPTLDFTER

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8QHM1	0.652	0.755	0.000	1354	0.596	0.693	A0A2R8QHM1.pdb.gz
2	AFDB:O15056	0.623	0.654	0.000	1496	0.414	0.436	O15056.pdb.gz	SYNJ2_HUMAN Synaptojanin-2 OS=Homo sapiens OX=9606 GN=SYNJ2 PE=1 SV=3
3	AFDB:O43426	0.999	0.999	0.000	1573	1.000	1.000	O43426.pdb.gz	SYNJ1_HUMAN Synaptojanin-1 OS=Homo sapiens OX=9606 GN=SYNJ1 PE=1 SV=2
4	AFDB:Q62910	0.716	0.716	0.000	1574	0.897	0.896	Q62910.pdb.gz	SYNJ1_RAT Synaptojanin-1 OS=Rattus norvegicus OX=10116 GN=Synj1 PE=1 SV=3
5	AFDB:Q54PV1	0.188	0.165	3.712E-30	1800	0.123	0.107	Q54PV1.pdb.gz	Q54PV1_DICDI Inositol 5-phosphatase OS=Dictyostelium discoideum OX=44689 GN=Dd5P2 PE=4 SV=1
6	PDB:7k1wF	0.233	0.724	1.857E-21	462	0.079	0.268	7k1wF.pdb.gz
7	PDB:4tu3X	0.211	0.776	6.415E-19	400	0.070	0.275	4tu3X.pdb.gz
8	PDB:2imqX	0.157	0.781	2.056E-17	280	0.045	0.254	2imqX.pdb.gz	Heme-assisted S-nitrosation of a proximal thiolate in a nitric oxide transport protein
9	PDB:4f1iA	0.111	0.433	2.173E-7	328	0.033	0.159	4f1iA.pdb.gz
10	PDB:1akoA	0.119	0.534	6.965E-6	268	0.024	0.142	1akoA.pdb.gz
11	PDB:7kiuA	0.106	0.468	9.375E-6	263	0.029	0.171	7kiuA.pdb.gz	Structural features of Dnase1L3 responsible for serum antigen clearance.
12	PDB:2j63A	0.110	0.381	3.234E-5	333	0.030	0.141	2j63A.pdb.gz
13	PDB:5vsuA	0.048	0.172	4.249E-4	387	0.020	0.080	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
14	AFDB:A8DYK5	0.066	0.076	6.190E-4	1306	0.100	0.121	A8DYK5.pdb.gz	A8DYK5_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Isha PE=1 SV=1
15	AFDB:Q14966	0.054	0.044	1.586E-3	1978	0.088	0.070	Q14966.pdb.gz	ZN638_HUMAN Zinc finger protein 638 OS=Homo sapiens OX=9606 GN=ZNF638 PE=1 SV=2
16	PDB:7oqcF	0.050	0.245	1.619E-3	267	0.014	0.082	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
17	PDB:3lqvB	0.045	0.478	2.289E-3	115	0.011	0.157	3lqvB.pdb.gz	Branch Recognition by SF3b14
18	AFDB:O95104	0.058	0.076	9.916E-3	1147	0.081	0.112	O95104.pdb.gz	SCAF4_HUMAN SR-related and CTD-associated factor 4 OS=Homo sapiens OX=9606 GN=SCAF4 PE=1 SV=3
19	AFDB:Q8I3A0	0.044	0.030	8.557E-1	2568	0.063	0.039	Q8I3A0.pdb.gz	Q8I3A0_PLAF7 Copper-transporting ATPase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0904900 PE=4 SV=2
20	AFDB:Q9UPS6	0.046	0.037	1.476	1966	0.072	0.057	Q9UPS6.pdb.gz	SET1B_HUMAN Histone-lysine N-methyltransferase SETD1B OS=Homo sapiens OX=9606 GN=SETD1B PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9QHF3	0.0	1788	1308	0.544	0.654	E9QHF3_DANRE phosphoinositide 5-phosphatase OS=Danio rerio OX=7955 GN=fb02f11 PE=1 SV=2
2	G5ECL2	0.0	851	1119	0.306	0.430	SYNJ_CAEEL Synaptojanin OS=Caenorhabditis elegans OX=6239 GN=unc-26 PE=1 SV=1
3	O15056	0.0	1174	1496	0.362	0.380	SYNJ2_HUMAN Synaptojanin-2 OS=Homo sapiens OX=9606 GN=SYNJ2 PE=1 SV=3
4	O18964	0.0	2331	1324	0.756	0.898	SYNJ1_BOVIN Synaptojanin-1 (Fragment) OS=Bos taurus OX=9913 GN=SYNJ1 PE=1 SV=2
5	O43426	0.0	3232	1573	1.000	1.000	SYNJ1_HUMAN Synaptojanin-1 OS=Homo sapiens OX=9606 GN=SYNJ1 PE=1 SV=2
6	O55207	0.0	1169	1496	0.366	0.384	SYNJ2_RAT Synaptojanin-2 OS=Rattus norvegicus OX=10116 GN=Synj2 PE=1 SV=2
7	Q5U0V7	0.0	1135	1218	0.350	0.452	Q5U0V7_DROME phosphoinositide 5-phosphatase OS=Drosophila melanogaster OX=7227 GN=Synj PE=1 SV=1
8	Q62910	0.0	2724	1574	0.893	0.892	SYNJ1_RAT Synaptojanin-1 OS=Rattus norvegicus OX=10116 GN=Synj1 PE=1 SV=3
9	Q8CHC4	0.0	2712	1574	0.888	0.888	SYNJ1_MOUSE Synaptojanin-1 OS=Mus musculus OX=10090 GN=Synj1 PE=1 SV=3
10	Q8MR94	0.0	837	959	0.259	0.425	Q8MR94_DROME phosphoinositide 5-phosphatase (Fragment) OS=Drosophila melanogaster OX=7227 GN=Synj PE=2 SV=1
11	Q9D2G5	0.0	1179	1434	0.369	0.404	SYNJ2_MOUSE Synaptojanin-2 OS=Mus musculus OX=10090 GN=Synj2 PE=1 SV=2
12	P50942	1.75e-132	444	1183	0.178	0.237	INP52_YEAST Polyphosphatidylinositol phosphatase INP52 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=INP52 PE=1 SV=1
13	O43001	9.53e-127	425	1076	0.192	0.281	SYJ1_SCHPO Inositol-1,4,5-trisphosphate 5-phosphatase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=syj1 PE=1 SV=1
14	Q12271	2.76e-125	422	1107	0.175	0.249	INP53_YEAST Polyphosphatidylinositol phosphatase INP53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=INP53 PE=1 SV=1
15	Q54D97	1.12e-121	417	1379	0.192	0.219	Q54D97_DICDI Inositol 5-phosphatase OS=Dictyostelium discoideum OX=44689 GN=Dd5P3 PE=4 SV=1
16	Q9USQ6	6.24e-84	298	889	0.145	0.256	SYJ2_SCHPO Inositol-1,4,5-trisphosphate 5-phosphatase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=syj2 PE=2 SV=1
17	P40559	3.93e-78	282	946	0.140	0.233	INP51_YEAST Phosphatidylinositol 4,5-bisphosphate 5-phosphatase INP51 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=INP51 PE=1 SV=1
18	A0A1D8PIH6	2.40e-74	271	986	0.138	0.220	A0A1D8PIH6_CANAL phosphoinositide 5-phosphatase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=INP51 PE=3 SV=1
19	Q8I7P3	1.11e-65	241	787	0.092	0.184	Q8I7P3_DICDI Inositol 5-phosphatase 4 OS=Dictyostelium discoideum OX=44689 GN=Dd5P4 PE=3 SV=1
20	Q55AW9	3.23e-62	226	581	0.097	0.263	SAC1_DICDI Phosphatidylinositol-3-phosphatase SAC1 OS=Dictyostelium discoideum OX=44689 GN=sac1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08952 DUF1866	9.4e-57	202.4	Domain of unknown function (DUF1866)
2	PF03372 Exo_endo_phos	2.2e-09	48.8	Endonuclease/Exonuclease/phosphatase family
3	PF00076 RRM_1	3.6e+02	12.4	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
4	PF02383 Syja_N	9.7e-66	233.9	SacI homology domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000409667

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000369981	0.999	Endophilin-A1
2	9606.ENSP00000348602	0.993	Amphiphysin
3	9606.ENSP00000362014	0.986	Dynamin-1
4	9606.ENSP00000360798	0.983	Epidermal growth factor receptor substrate 15
5	9606.ENSP00000351926	0.978	AP-2 complex subunit alpha-1
6	9606.ENSP00000370719	0.978	Intersectin-1
7	9606.ENSP00000292807	0.970	AP-2 complex subunit mu
8	9606.ENSP00000316779	0.967	Myc box-dependent-interacting protein 1
9	9606.ENSP00000377015	0.966	Phosphatidylinositol-binding clathrin assembly protein
10	9606.ENSP00000074304	0.946	Type I inositol 3,4-bisphosphate 4-phosphatase
11	9606.ENSP00000376345	0.945	Growth factor receptor-bound protein 2
12	9606.ENSP00000373713	0.943	Phosphatidylinositide phosphatase SAC1
13	9606.ENSP00000363763	0.941	Ephrin type-B receptor 2
14	9606.ENSP00000406209	0.941	Epsin-1
15	9606.ENSP00000361021	0.936	Phosphatase and tensin homolog
16	9606.ENSP00000466363	0.932	Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma
17	9606.ENSP00000378323	0.929	Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform
18	9606.ENSP00000363046	0.925	Inositol polyphosphate multikinase
19	9606.ENSP00000361064	0.921	Multiple inositol polyphosphate phosphatase 1
20	9606.ENSP00000425487	0.920	Type II inositol 3,4-bisphosphate 4-phosphatase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0034596	1.000	phosphatidylinositol phosphate 4-phosphatase activity
GO:0004439	0.999	phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity
GO:0046030	0.987	inositol trisphosphate phosphatase activity
GO:0005488	0.981	binding
GO:0004438	0.937	phosphatidylinositol-3-phosphate phosphatase activity
GO:0005515	0.932	protein binding
GO:0106018	0.914	phosphatidylinositol-3,5-bisphosphate phosphatase activity
GO:0052658	0.648	inositol-1,4,5-trisphosphate 5-phosphatase activity
GO:0043813	0.423	phosphatidylinositol-3,5-bisphosphate 5-phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.981	cellular process
GO:0051234	0.965	establishment of localization
GO:0006810	0.963	transport
GO:0023052	0.962	signaling
GO:0050794	0.961	regulation of cellular process
GO:0050896	0.959	response to stimulus
GO:0007154	0.956	cell communication
GO:0048518	0.955	positive regulation of biological process
GO:0051649	0.952	establishment of localization in cell
GO:0016043	0.947	cellular component organization
GO:0051648	0.942	vesicle localization
GO:0032501	0.929	multicellular organismal process
GO:0007267	0.926	cell-cell signaling
GO:0099537	0.914	trans-synaptic signaling
GO:0007268	0.903	chemical synaptic transmission
GO:0071704	0.872	organic substance metabolic process
GO:0032502	0.866	developmental process
GO:0051128	0.856	regulation of cellular component organization
GO:0046488	0.847	phosphatidylinositol metabolic process
GO:0048856	0.841	anatomical structure development
GO:0051656	0.832	establishment of organelle localization
GO:0051650	0.810	establishment of vesicle localization
GO:0043647	0.786	inositol phosphate metabolic process
GO:0099518	0.743	vesicle cytoskeletal trafficking
GO:0030182	0.696	neuron differentiation
GO:0016192	0.685	vesicle-mediated transport
GO:0009653	0.679	anatomical structure morphogenesis
GO:0050808	0.641	synapse organization
GO:0048522	0.641	positive regulation of cellular process
GO:0032879	0.640	regulation of localization
GO:0099504	0.609	synaptic vesicle cycle
GO:0051049	0.603	regulation of transport
GO:0006897	0.597	endocytosis
GO:0051716	0.515	cellular response to stimulus
GO:0009605	0.479	response to external stimulus
GO:0048513	0.452	animal organ development
GO:0048468	0.444	cell development
GO:0009628	0.442	response to abiotic stimulus
GO:0051606	0.343	detection of stimulus
GO:0009584	0.323	detection of visible light
GO:1901576	0.306	organic substance biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0030054	0.995	cell junction
GO:0005829	0.993	cytosol
GO:0016020	0.990	membrane
GO:0045202	0.990	synapse
GO:0032991	0.972	protein-containing complex
GO:0043229	0.891	intracellular organelle
GO:0043231	0.811	intracellular membrane-bounded organelle
GO:0071944	0.601	cell periphery
GO:0098793	0.585	presynapse
GO:0005886	0.575	plasma membrane
GO:0098796	0.533	membrane protein complex
GO:0012505	0.531	endomembrane system
GO:0030117	0.388	membrane coat
GO:0030118	0.375	clathrin coat

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:22764	0.999	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol 4-phosphate) + phosphate
EC:3.1.3.36	0.999	phosphoinositide 5-phosphatase.
RHEA:12316	0.937	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + H2O = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + phosphate
EC:3.1.3.64	0.937	phosphatidylinositol-3-phosphatase.
RHEA:19797	0.648	1D-myo-inositol 1,4,5-trisphosphate + H2O = 1D-myo-inositol 1,4-bisphosphate + phosphate
EC:3.1.3.56	0.648	inositol-polyphosphate 5-phosphatase.

[back to server]