StarFunc result for job id O43432

User Input

>input (1585 residues)
MNSQPQTRSPFFQRPQIQPPRATIPNSSPSIRPGAQTPTAVYQANQHIMMVNHLPMPYPV
PQGPQYCIPQYRHSGPPYVGPPQQYPVQPPGPGPFYPGPGPGDFPNAYGTPFYPSQPVYQ
SAPIIVPTQQQPPPAKREKKTIRIRDPNQGGKDITEEIMSGGGSRNPTPPIGRPTSTPTP
PQQLPSQVPEHSPVVYGTVESAHLAASTPVTAASDQKQEEKPKPDPVLKSPSPVLRLVLS
GEKKEQEGQTSETTAIVSIAELPLPPSPTTVSSVARSTIAAPTSSALSSQPIFTTAIDDR
CELSSPREDTIPIPSLTSCTETSDPLPTNENDDDICKKPCSVAPNDIPLVSSTNLINEIN
GVSEKLSATESIVEIVKQEVLPLTLELEILENPPEEMKLECIPAPITPSTVPSFPPTPPT
PPASPPHTPVIVPAAATTVSSPSAAITVQRVLEEDESIRTCLSEDAKEIQNKIEVEADGQ
TEEILDSQNLNSRRSPVPAQIAITVPKTWKKPKDRTRTTEEMLEAELELKAEEELSIDKV
LESEQDKMSQGFHPERDPSDLKKVKAVEENGEEAEPVRNGAESVSEGEGIDANSGSTDSS
GDGVTFPFKPESWKPTDTEGKKQYDREFLLDFQFMPACIQKPEGLPPISDVVLDKINQPK
LPMRTLDPRILPRGPDFTPAFADFGRQTPGGRGVPLLNVGSRRSQPGQRREPRKIITVSV
KEDVHLKKAENAWKPSQKRDSQADDPENIKTQELFRKVRSILNKLTPQMFNQLMKQVSGL
TVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLVTLKVPMADKPGNTVNFRKLLLNR
CQKEFEKDKADDDVFEKKQKELEAASAPEERTRLHDELEEAKDKARRRSIGNIKFIGELF
KLKMLTEAIMHDCVVKLLKNHDEESLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIV
KERKTSSRIRFMLQDVIDLRLCNWVSRRADQGPKTIEQIHKEAKIEEQEEQRKVQQLMTK
EKRRPGVQRVDEGGWNTVQGAKNSRVLDPSKFLKITKPTIDEKIQLVPKAQLGSWGKGSS
GGAKASETDALRSSASSLNRFSALQPPAPSGSTPSTPVEFDSRRTLTSRGSMGREKNDKP
LPSATARPNTFMRGGSSKDLLDNQSQEEQRREMLETVKQLTGGVDVERNSTEAERNKTRE
SAKPEISAMSAHDKAALSEEELERKSKSIIDEFLHINDFKEAMQCVEELNAQGLLHVFVR
VGVESTLERSQITRDHMGQLLYQLVQSEKLSKQDFFKGFSETLELADDMAIDIPHIWLYL
AELVTPMLKEGGISMRELTIEFSKPLLPVGRAGVLLSEILHLLCKQMSHKKVGALWREAD
LSWKDFLPEGEDVHNFLLEQKLDFIESDSPCSSEALSKKELSAEELYKRLEKLIIEDKAN
DEQIFDWVEANLDEIQMSSPTFLRALMTAVCKAAIIADSSTFRVDTAVIKQRVPILLKYL
DSDTEKELQALYALQASIVKLDQPANLLRMFFDCLYDEEVISEDAFYKWESSKDPAEQNG
KGVALKSVTAFFTWLREAEEESEDN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43432	1.000	1.000	0.000	1585	1.000	1.000	O43432.pdb.gz	IF4G3_HUMAN Eukaryotic translation initiation factor 4 gamma 3 OS=Homo sapiens OX=9606 GN=EIF4G3 PE=1 SV=2
2	AFDB:Q80XI3	0.327	0.328	0.000	1579	0.869	0.872	Q80XI3.pdb.gz	IF4G3_MOUSE Eukaryotic translation initiation factor 4 gamma 3 OS=Mus musculus OX=10090 GN=Eif4g3 PE=1 SV=2
3	AFDB:A8DZ29	0.173	0.146	6.901E-38	1919	0.237	0.195	A8DZ29.pdb.gz	A8DZ29_DROME Eukaryotic translation initiation factor 4G1, isoform B OS=Drosophila melanogaster OX=7227 GN=eIF4G1 PE=1 SV=1
4	AFDB:C9JF13	0.149	0.252	2.242E-33	903	0.263	0.462	C9JF13.pdb.gz	C9JF13_HUMAN Eukaryotic translation initiation factor 4 gamma 1 (Fragment) OS=Homo sapiens OX=9606 GN=EIF4G1 PE=1 SV=1
5	AFDB:Q76E23	0.154	0.143	1.911E-29	1727	0.208	0.191	Q76E23.pdb.gz	IF4G_ARATH Eukaryotic translation initiation factor 4G OS=Arabidopsis thaliana OX=3702 GN=EIF4G PE=1 SV=2
6	AFDB:Q9VCH1	0.174	0.138	1.985E-27	2072	0.199	0.153	Q9VCH1.pdb.gz	Q9VCH1_DROME Eukaryotic translation initiation factor 4G2, isoform A OS=Drosophila melanogaster OX=7227 GN=eIF4G2 PE=1 SV=2
7	AFDB:C9K073	0.083	0.144	4.018E-21	869	0.221	0.403	C9K073.pdb.gz	C9K073_HUMAN Eukaryotic translation initiation factor 4 gamma 1 (Fragment) OS=Homo sapiens OX=9606 GN=EIF4G1 PE=1 SV=1
8	AFDB:F4IZM8	0.055	0.060	1.376E-5	1347	0.105	0.123	F4IZM8.pdb.gz	HUAL3_ARATH Protein HUA2-LIKE 3 OS=Arabidopsis thaliana OX=3702 GN=HULK3 PE=2 SV=1
9	AFDB:F4IN78	0.058	0.063	4.480E-5	1366	0.093	0.108	F4IN78.pdb.gz	HUAL2_ARATH Protein HUA2-LIKE 2 OS=Arabidopsis thaliana OX=3702 GN=HULK2 PE=2 SV=2
10	PDB:7dvqV	0.115	0.350	1.135E-4	468	0.048	0.162	7dvqV.pdb.gz	Structure of the activated human minor spliceosome.
11	AFDB:Q8N3D4	0.045	0.046	2.249E-4	1523	0.126	0.131	Q8N3D4.pdb.gz	EH1L1_HUMAN EH domain-binding protein 1-like protein 1 OS=Homo sapiens OX=9606 GN=EHBP1L1 PE=1 SV=2
12	PDB:4jhjA	0.103	0.652	2.305E-4	216	0.030	0.222	4jhjA.pdb.gz	Structural and biochemical studies of SLIP1-SLBP identify DBP5 and eIF3g as SLIP1-binding proteins.
13	PDB:1h2uA	0.102	0.209	8.785E-4	706	0.057	0.129	1h2uA.pdb.gz	Large-Scale Induced Fit Recognition of an M(7)Gpppg CAP Analogue by the Human Nuclear CAP-Binding Complex
14	PDB:5mqfT	0.108	0.394	2.259E-3	395	0.023	0.094	5mqfT.pdb.gz	Cryo-EM structure of a human spliceosome activated for step 2 of splicing.
15	PDB:5gm6Z	0.099	0.313	5.584E-3	447	0.049	0.174	5gm6Z.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
16	PDB:6bk8L	0.106	0.372	1.681E-2	412	0.040	0.155	6bk8L.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
17	PDB:5oobF	0.104	0.214	1.818E-2	718	0.055	0.121	5oobF.pdb.gz	Structural basis for mutually exclusive co-transcriptional nuclear cap-binding complexes with either NELF-E or ARS2.
18	PDB:7f66J	0.081	0.200	5.472E-2	591	0.020	0.054	7f66J.pdb.gz
19	PDB:7q2xD	0.060	0.084	1.027E-1	994	0.043	0.068	7q2xD.pdb.gz	Clamping of DNA shuts the condensin neck gate.
20	PDB:3gniA	0.066	0.194	1.301E-1	335	0.036	0.170	3gniA.pdb.gz	ATP and MO25alpha regulate the conformational state of the STRADalpha pseudokinase and activation of the LKB1 tumour suppressor

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B2RU06	0.0	1120	1606	0.389	0.384	B2RU06_HUMAN eIF4G1 protein OS=Homo sapiens OX=9606 GN=EIF4G1 PE=2 SV=1
2	B2RU10	0.0	1120	1606	0.389	0.384	B2RU10_HUMAN eIF4G1 protein OS=Homo sapiens OX=9606 GN=EIF4G1 PE=2 SV=1
3	B4DGF1	0.0	1118	1566	0.389	0.393	B4DGF1_HUMAN cDNA FLJ56479, highly similar to Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 PE=2 SV=1
4	D3ZU13	0.0	1093	1598	0.396	0.393	D3ZU13_RAT Eukaryotic translation initiation factor 4 gamma, 1 OS=Rattus norvegicus OX=10116 GN=Eif4g1 PE=1 SV=1
5	D4AD15	0.0	1093	1634	0.396	0.384	D4AD15_RAT Eukaryotic translation initiation factor 4 gamma, 1 OS=Rattus norvegicus OX=10116 GN=Eif4g1 PE=1 SV=3
6	E7EUU4	0.0	1121	1560	0.389	0.396	E7EUU4_HUMAN Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1 PE=1 SV=1
7	M0RD03	0.0	1093	1641	0.396	0.383	M0RD03_RAT Eukaryotic translation initiation factor 4 gamma, 1 OS=Rattus norvegicus OX=10116 GN=Eif4g1 PE=1 SV=2
8	O43432	0.0	3240	1585	1.000	1.000	IF4G3_HUMAN Eukaryotic translation initiation factor 4 gamma 3 OS=Homo sapiens OX=9606 GN=EIF4G3 PE=1 SV=2
9	Q04637	0.0	1120	1599	0.389	0.385	IF4G1_HUMAN Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1 PE=1 SV=4
10	Q4LE58	0.0	1118	1624	0.389	0.379	Q4LE58_HUMAN eIF4G1 variant protein (Fragment) OS=Homo sapiens OX=9606 GN=EIF4G1 variant protein PE=2 SV=1
11	Q6NZJ6	0.0	1083	1600	0.378	0.374	IF4G1_MOUSE Eukaryotic translation initiation factor 4 gamma 1 OS=Mus musculus OX=10090 GN=Eif4g1 PE=1 SV=1
12	Q80XI3	0.0	2631	1579	0.869	0.873	IF4G3_MOUSE Eukaryotic translation initiation factor 4 gamma 3 OS=Mus musculus OX=10090 GN=Eif4g3 PE=1 SV=2
13	C9K073	6.50e-93	324	869	0.124	0.227	C9K073_HUMAN Eukaryotic translation initiation factor 4 gamma 1 (Fragment) OS=Homo sapiens OX=9606 GN=EIF4G1 PE=1 SV=1
14	A8DZ29	8.31e-92	333	1919	0.189	0.156	A8DZ29_DROME Eukaryotic translation initiation factor 4G1, isoform B OS=Drosophila melanogaster OX=7227 GN=eIF4G1 PE=1 SV=1
15	O61380	1.02e-91	332	1666	0.189	0.180	O61380_DROME Eukaryotic translation initiation factor 4G1, isoform A OS=Drosophila melanogaster OX=7227 GN=eIF4G1 PE=1 SV=3
16	C9J2Z7	1.14e-75	272	833	0.109	0.206	C9J2Z7_HUMAN Eukaryotic translation initiation factor 4 gamma 1 (Fragment) OS=Homo sapiens OX=9606 GN=EIF4G1 PE=1 SV=8
17	A0A1S3C4H6	7.68e-58	223	1888	0.073	0.061	IF4G_CUCME Eukaryotic translation initiation factor 4G OS=Cucumis melo OX=3656 GN=eIF4G PE=1 SV=1
18	Q5KTT7	3.97e-51	198	891	0.072	0.128	Q5KTT7_DANRE Eukaryotic translation initiation factor 4, gamma 2a OS=Danio rerio OX=7955 GN=NAT1A PE=1 SV=1
19	H0YCH5	3.83e-50	187	444	0.073	0.261	H0YCH5_HUMAN Eukaryotic translation initiation factor 4 gamma 2 (Fragment) OS=Homo sapiens OX=9606 GN=EIF4G2 PE=1 SV=2
20	Q76E23	5.84e-50	197	1727	0.071	0.065	IF4G_ARATH Eukaryotic translation initiation factor 4G OS=Arabidopsis thaliana OX=3702 GN=EIF4G PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02847 MA3	1.9e-27	106.9	MA3 domain
2	PF02854 MIF4G	3.8e-65	231.1	MIF4G domain
3	PF02503 PP_kinase	80	14.3	Polyphosphate kinase middle domain
4	PF02020 W2	2.7e-15	67.6	eIF4-gamma/eIF5/eIF2-epsilon

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000000510

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000059150	0.996	Uncharacterized protein
2	9598.ENSPTRP00000014825	0.995	ATP-dependent RNA helicase which is a subunit of the eIF4F complex involved in cap recognition and is required for mRNA binding to ribosome. In the current model of translation initiation, eIF4A unwinds RNA secondary structures in the 5'-UTR of mRNAs which is necessary to allow efficient binding of the small ribosomal subunit, and subsequent scanning for the initiator codon (By similarity)
3	9598.ENSPTRP00000027042	0.994	Pan troglodytes eukaryotic translation initiation factor 4A2 (EIF4A2), mRNA
4	9598.ENSPTRP00000005869	0.982	Eukaryotic translation initiation factor 4 gamma, 2
5	9598.ENSPTRP00000026995	0.979	Uncharacterized protein
6	9598.ENSPTRP00000022300	0.969	Eukaryotic translation initiation factor 4E family member 2
7	9598.ENSPTRP00000047824	0.953	Uncharacterized protein
8	9598.ENSPTRP00000032202	0.947	Eukaryotic translation initiation factor 3 subunit B
9	9598.ENSPTRP00000005269	0.942	Eukaryotic translation initiation factor 3 subunit A
10	9598.ENSPTRP00000013568	0.940	Eukaryotic translation initiation factor 3 subunit C
11	9598.ENSPTRP00000041427	0.938	Polyadenylate-binding protein
12	9598.ENSPTRP00000010961	0.912	Eukaryotic translation initiation factor 2, subunit 1 alpha, 35kDa
13	9598.ENSPTRP00000015627	0.905	Uncharacterized protein
14	9598.ENSPTRP00000022998	0.902	Uncharacterized protein
15	9598.ENSPTRP00000026075	0.895	Uncharacterized protein
16	9598.ENSPTRP00000039458	0.894	Polyadenylate-binding protein
17	9598.ENSPTRP00000023243	0.878	Polyadenylate-binding protein
18	9598.ENSPTRP00000036173	0.875	Nuclear cap binding protein subunit 1, 80kDa
19	9598.ENSPTRP00000054742	0.873	Uncharacterized protein
20	9598.ENSPTRP00000025478	0.863	Eukaryotic translation initiation factor 1B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000339	1.000	RNA cap binding
GO:0008135	0.998	translation factor activity, RNA binding
GO:0031369	0.577	translation initiation factor binding
GO:0008190	0.573	eukaryotic initiation factor 4E binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0050794	0.994	regulation of cellular process
GO:0060255	0.978	regulation of macromolecule metabolic process
GO:0031323	0.976	regulation of cellular metabolic process
GO:0051171	0.975	regulation of nitrogen compound metabolic process
GO:0080090	0.970	regulation of primary metabolic process
GO:0006417	0.955	regulation of translation
GO:0006446	0.860	regulation of translational initiation
GO:0009987	0.826	cellular process
GO:0071704	0.780	organic substance metabolic process
GO:0044238	0.727	primary metabolic process
GO:0043170	0.724	macromolecule metabolic process
GO:0006807	0.671	nitrogen compound metabolic process
GO:0044237	0.580	cellular metabolic process
GO:0034641	0.460	cellular nitrogen compound metabolic process
GO:0010467	0.380	gene expression
GO:0048518	0.351	positive regulation of biological process
GO:0048522	0.335	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.995	cytoplasm
GO:0032991	0.993	protein-containing complex
GO:0005829	0.989	cytosol
GO:0016281	0.803	eukaryotic translation initiation factor 4F complex
GO:0031981	0.536	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]