StarFunc result for job id O43435

User Input

>input (398 residues)
MHFSTVTRDMEAFTASSLSSLGAAGGFPGAASPGADPYGPREPPPPPPRYDPCAAAAPGA
PGPPPPPHAYPFAPAAGAATSAAAEPEGPGASCAAAAKAPVKKNAKVAGVSVQLEMKALW
DEFNQLGTEMIVTKAGRRMFPTFQVKLFGMDPMADYMLLMDFVPVDDKRYRYAFHSSSWL
VAGKADPATPGRVHYHPDSPAKGAQWMKQIVSFDKLKLTNNLLDDNGHIILNSMHRYQPR
FHVVYVDPRKDSEKYAEENFKTFVFEETRFTAVTAYQNHRITQLKIASNPFAKGFRDCDP
EDWPRNHRPGALPLMSAFARSRNPVASPTQPSGTEKGGHVLKDKEVKAETSRNTPEREVE
LLRDAGGCVNLGLPCPAECQPFNTQGLVAGRTAGDRLC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43435	1.000	1.000	3.526E-76	398	1.000	1.000	O43435.pdb.gz	TBX1_HUMAN T-box transcription factor TBX1 OS=Homo sapiens OX=9606 GN=TBX1 PE=1 SV=1
2	AFDB:P70323	0.619	0.517	1.760E-59	479	0.796	0.662	P70323.pdb.gz	TBX1_MOUSE T-box transcription factor TBX1 OS=Mus musculus OX=10090 GN=Tbx1 PE=1 SV=2
3	AFDB:Q8AX98	0.625	0.540	3.851E-55	463	0.676	0.581	Q8AX98.pdb.gz	TBX1A_XENLA T-box transcription factor TBX1-A OS=Xenopus laevis OX=8355 GN=tbx1-a PE=1 SV=1
4	AFDB:Q8AXX2	0.547	0.476	3.097E-53	460	0.641	0.554	Q8AXX2.pdb.gz	TBX1_DANRE T-box transcription factor TBX1 OS=Danio rerio OX=7955 GN=tbx1 PE=2 SV=1
5	AFDB:O75333	0.536	0.554	3.649E-45	385	0.515	0.532	O75333.pdb.gz	TBX10_HUMAN T-box transcription factor TBX10 OS=Homo sapiens OX=9606 GN=TBX10 PE=2 SV=2
6	AFDB:Q9UMR3	0.474	0.422	2.257E-35	447	0.369	0.329	Q9UMR3.pdb.gz	TBX20_HUMAN T-box transcription factor TBX20 OS=Homo sapiens OX=9606 GN=TBX20 PE=1 SV=4
7	AFDB:O70306	0.461	0.307	4.985E-35	602	0.372	0.246	O70306.pdb.gz	TBX15_MOUSE T-box transcription factor TBX15 OS=Mus musculus OX=10090 GN=Tbx15 PE=1 SV=2
8	AFDB:Q9I9K7	0.488	0.437	6.760E-35	446	0.389	0.348	Q9I9K7.pdb.gz	TBX20_DANRE T-box transcription factor TBX20 OS=Danio rerio OX=7955 GN=tbx20 PE=2 SV=1
9	AFDB:Q8JFF9	0.451	0.326	1.905E-34	554	0.357	0.256	Q8JFF9.pdb.gz	Q8JFF9_DANRE T-box containing transcription factor OS=Danio rerio OX=7955 GN=tbx18 PE=2 SV=1
10	AFDB:P70325	0.465	0.338	2.179E-33	552	0.362	0.261	P70325.pdb.gz	TBX4_MOUSE T-box transcription factor TBX4 OS=Mus musculus OX=10090 GN=Tbx4 PE=1 SV=3
11	PDB:7ea3J	0.146	0.075	5.952E-3	883	0.048	0.022	7ea3J.pdb.gz
12	PDB:4ziqA	0.146	0.049	3.085E-2	1450	0.040	0.011	4ziqA.pdb.gz
13	PDB:1fuxA	0.165	0.322	3.936E-2	165	0.050	0.121	1fuxA.pdb.gz
14	PDB:5w0pC	0.122	0.067	4.446E-2	850	0.038	0.018	5w0pC.pdb.gz
15	PDB:7b0xC	0.126	0.198	4.446E-2	211	0.048	0.090	7b0xC.pdb.gz
16	PDB:2r51A	0.161	0.209	4.725E-2	288	0.035	0.049	2r51A.pdb.gz
17	PDB:1ezvX	0.171	0.414	6.030E-2	127	0.035	0.110	1ezvX.pdb.gz	Structure at 2.3 A resolution of the cytochrome bc(1) complex from the yeast Saccharomyces cerevisiae co-crystallized with an antibody Fv fragment.
18	PDB:4f38B	0.148	0.245	6.408E-2	192	0.040	0.083	4f38B.pdb.gz	Quantitative Analysis of Prenylated RhoA Interaction with Its Chaperone, RhoGDI.
19	PDB:6xreM	0.148	0.179	6.811E-2	314	0.055	0.070	6xreM.pdb.gz	Structure of the p53/RNA polymerase II assembly.
20	PDB:6iggA	0.180	0.350	7.694E-2	170	0.055	0.129	6iggA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43435	0.0	822	398	1.000	1.000	TBX1_HUMAN T-box transcription factor TBX1 OS=Homo sapiens OX=9606 GN=TBX1 PE=1 SV=1
2	Q8AX98	0.0	514	463	0.676	0.581	TBX1A_XENLA T-box transcription factor TBX1-A OS=Xenopus laevis OX=8355 GN=tbx1-a PE=1 SV=1
3	P70323	1.34e-177	505	479	0.608	0.505	TBX1_MOUSE T-box transcription factor TBX1 OS=Mus musculus OX=10090 GN=Tbx1 PE=1 SV=2
4	Q8AXX2	8.88e-176	499	460	0.628	0.543	TBX1_DANRE T-box transcription factor TBX1 OS=Danio rerio OX=7955 GN=tbx1 PE=2 SV=1
5	O75333	1.22e-132	387	385	0.465	0.481	TBX10_HUMAN T-box transcription factor TBX10 OS=Homo sapiens OX=9606 GN=TBX10 PE=2 SV=2
6	Q9W3F4	2.28e-95	301	699	0.347	0.197	Q9W3F4_DROME Optomotor-blind-related-gene-1, isoform A OS=Drosophila melanogaster OX=7227 GN=org-1 PE=4 SV=1
7	O62535	2.94e-95	301	712	0.347	0.194	O62535_DROME Optomotor-blind-related gene-1 protein OS=Drosophila melanogaster OX=7227 GN=org-1 PE=2 SV=1
8	Q8UW76	1.61e-86	271	440	0.332	0.300	TBX20_CHICK T-box transcription factor TBX20 OS=Gallus gallus OX=9031 GN=TBX20 PE=2 SV=1
9	Q9UMR3	8.21e-86	270	447	0.339	0.302	TBX20_HUMAN T-box transcription factor TBX20 OS=Homo sapiens OX=9606 GN=TBX20 PE=1 SV=4
10	Q9I9K7	3.76e-85	268	446	0.314	0.280	TBX20_DANRE T-box transcription factor TBX20 OS=Danio rerio OX=7955 GN=tbx20 PE=2 SV=1
11	Q9ES03	5.62e-85	267	445	0.319	0.285	TBX20_MOUSE T-box transcription factor TBX20 OS=Mus musculus OX=10090 GN=Tbx20 PE=2 SV=3
12	Q8AXW8	3.22e-84	265	441	0.319	0.288	TBX20_XENLA T-box transcription factor TBX20 OS=Xenopus laevis OX=8355 GN=tbx20 PE=2 SV=1
13	O93288	8.27e-79	254	541	0.319	0.235	O93288_CHICK T-Box protein 4 OS=Gallus gallus OX=9031 GN=TBX4 PE=1 SV=1
14	Q9IAK8	2.24e-78	252	492	0.307	0.248	TBX5A_DANRE T-box transcription factor TBX5-A OS=Danio rerio OX=7955 GN=tbx5a PE=2 SV=2
15	P70325	6.88e-78	252	552	0.319	0.230	TBX4_MOUSE T-box transcription factor TBX4 OS=Mus musculus OX=10090 GN=Tbx4 PE=1 SV=3
16	P57082	7.42e-78	252	545	0.324	0.237	TBX4_HUMAN T-box transcription factor TBX4 OS=Homo sapiens OX=9606 GN=TBX4 PE=1 SV=2
17	O95935	7.34e-77	251	607	0.289	0.189	TBX18_HUMAN T-box transcription factor TBX18 OS=Homo sapiens OX=9606 GN=TBX18 PE=1 SV=3
18	Q9EPZ6	7.45e-77	251	613	0.289	0.188	TBX18_MOUSE T-box transcription factor TBX18 OS=Mus musculus OX=10090 GN=Tbx18 PE=1 SV=1
19	P70326	1.21e-76	248	518	0.307	0.236	TBX5_MOUSE T-box transcription factor TBX5 OS=Mus musculus OX=10090 GN=Tbx5 PE=1 SV=2
20	Q99593	1.24e-76	248	518	0.307	0.236	TBX5_HUMAN T-box transcription factor TBX5 OS=Homo sapiens OX=9606 GN=TBX5 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00907 T-box	1.8e-75	264.5	T-box

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000331791

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000425979	0.892	Ribonuclease 3
2	9606.ENSP00000382237	0.805	Transmembrane protein 26
3	9606.ENSP00000327758	0.789	Homeobox protein Nkx-2.5
4	9606.ENSP00000331313	0.748	G protein subunit beta 1 like
5	9606.ENSP00000310275	0.698	Barrier-to-autointegration factor
6	9606.ENSP00000262999	0.649	Mitochondrial brown fat uncoupling protein 1
7	9606.ENSP00000320209	0.633	Cell death activator CIDE-A
8	9606.ENSP00000391311	0.633	Septin-5
9	9606.ENSP00000270722	0.632	PR domain zinc finger protein 16
10	9606.ENSP00000215882	0.630	Tricarboxylate transport protein, mitochondrial
11	9606.ENSP00000320089	0.628	Homeobox protein Nkx-2.6
12	9606.ENSP00000263208	0.601	Protein HIRA
13	9606.ENSP00000349577	0.601	Proline dehydrogenase
14	9606.ENSP00000331734	0.596	Protein ripply3
15	9606.ENSP00000230658	0.591	Insulin gene enhancer protein ISL-1
16	9606.ENSP00000086933	0.589	Homeobox protein goosecoid-2
17	9606.ENSP00000478699	0.589	Tumor necrosis factor receptor superfamily member 9
18	9606.ENSP00000357040	0.584	Vang-like protein 2
19	9606.ENSP00000383382	0.578	Platelet glycoprotein Ib beta chain
20	9606.ENSP00000346300	0.576	Crk-like protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0042803	0.998	protein homodimerization activity
GO:0140110	0.957	transcription regulator activity
GO:0003700	0.952	DNA-binding transcription factor activity
GO:0000976	0.913	transcription cis-regulatory region binding
GO:0000981	0.506	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.427	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032502	0.988	developmental process
GO:0065007	0.982	biological regulation
GO:0050789	0.974	regulation of biological process
GO:0009653	0.968	anatomical structure morphogenesis
GO:0050794	0.962	regulation of cellular process
GO:0032501	0.941	multicellular organismal process
GO:0007275	0.927	multicellular organism development
GO:0009887	0.885	animal organ morphogenesis
GO:0006355	0.884	regulation of DNA-templated transcription
GO:0048731	0.861	system development
GO:0048522	0.856	positive regulation of cellular process
GO:0045935	0.821	positive regulation of nucleobase-containing compound metabolic process
GO:0048568	0.765	embryonic organ development
GO:0010604	0.749	positive regulation of macromolecule metabolic process
GO:0048598	0.695	embryonic morphogenesis
GO:0072359	0.669	circulatory system development
GO:0009891	0.632	positive regulation of biosynthetic process
GO:0051254	0.612	positive regulation of RNA metabolic process
GO:0010557	0.593	positive regulation of macromolecule biosynthetic process
GO:0043009	0.581	chordate embryonic development
GO:0031328	0.578	positive regulation of cellular biosynthetic process
GO:1902680	0.573	positive regulation of RNA biosynthetic process
GO:0009987	0.552	cellular process
GO:0001501	0.462	skeletal system development
GO:0007507	0.461	heart development
GO:0035270	0.453	endocrine system development
GO:0048732	0.448	gland development
GO:0048562	0.447	embryonic organ morphogenesis
GO:0045893	0.435	positive regulation of DNA-templated transcription
GO:0060037	0.416	pharyngeal system development
GO:0002520	0.384	immune system development
GO:1904888	0.364	cranial skeletal system development
GO:0048705	0.361	skeletal system morphogenesis
GO:0048706	0.360	embryonic skeletal system development
GO:0048538	0.358	thymus development
GO:0048704	0.345	embryonic skeletal system morphogenesis
GO:0048701	0.321	embryonic cranial skeleton morphogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0043233	0.508	organelle lumen
GO:0070013	0.504	intracellular organelle lumen
GO:0031981	0.483	nuclear lumen
GO:0005654	0.434	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]