StarFunc result for job id O43447

User Input

>input (177 residues)
MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGY
KGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTN
GCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43447	1.000	1.000	9.033E-38	177	1.000	1.000	O43447.pdb.gz	PPIH_HUMAN Peptidyl-prolyl cis-trans isomerase H OS=Homo sapiens OX=9606 GN=PPIH PE=1 SV=1
2	PDB:1mzwA	0.957	0.978	1.294E-35	173	0.977	1.000	1mzwA.pdb.gz
3	AFDB:B0V156	0.954	0.894	5.133E-34	189	0.876	0.820	B0V156.pdb.gz
4	AFDB:Q4V5H1	0.970	0.938	1.745E-32	183	0.757	0.732	Q4V5H1.pdb.gz	Q4V5H1_DROME Peptidyl-prolyl cis-trans isomerase OS=Drosophila melanogaster OX=7227 GN=Dmel\CG17266 PE=1 SV=1
5	AFDB:Q9ZVJ4	0.978	0.870	1.797E-31	199	0.712	0.633	Q9ZVJ4.pdb.gz	CYP22_ARATH Peptidyl-prolyl cis-trans isomerase CYP22 OS=Arabidopsis thaliana OX=3702 GN=CYP22 PE=2 SV=1
6	AFDB:Q7ZVQ9	0.873	0.854	9.632E-30	181	0.768	0.751	Q7ZVQ9.pdb.gz	Q7ZVQ9_DANRE Peptidyl-prolyl cis-trans isomerase OS=Danio rerio OX=7955 GN=zgc:136730 PE=1 SV=1
7	AFDB:O74729	0.950	0.972	7.464E-29	173	0.593	0.607	O74729.pdb.gz	PPIH_SCHPO Peptidyl-prolyl cis-trans isomerase cyp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cyp3 PE=3 SV=1
8	AFDB:Q6IQF8	0.849	0.701	2.328E-28	215	0.763	0.628	Q6IQF8.pdb.gz
9	AFDB:Q8I6S4	0.964	0.787	3.570E-27	217	0.582	0.475	Q8I6S4.pdb.gz	Q8I6S4_PLAF7 Peptidyl-prolyl cis-trans isomerase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0804800 PE=3 SV=1
10	AFDB:P52016	0.942	0.378	3.281E-26	447	0.520	0.206	P52016.pdb.gz	CYP8_CAEEL Peptidyl-prolyl cis-trans isomerase 8 OS=Caenorhabditis elegans OX=6239 GN=cyn-8 PE=2 SV=2
11	AFDB:Q8X166	0.911	0.761	4.119E-26	212	0.548	0.458	Q8X166.pdb.gz	PPIB_ASPNG Peptidyl-prolyl cis-trans isomerase B OS=Aspergillus niger OX=5061 GN=cypB PE=1 SV=1
12	PDB:1ihgA	0.932	0.458	8.534E-25	364	0.571	0.277	1ihgA.pdb.gz
13	PDB:5yzg1	0.894	0.654	1.689E-24	243	0.554	0.403	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome
14	PDB:1h0pA	0.891	0.867	1.892E-24	182	0.531	0.516	1h0pA.pdb.gz
15	PDB:1vdnA	0.879	0.965	2.003E-24	161	0.531	0.584	1vdnA.pdb.gz	Crystal Structure Of Yeast Cyclophilin A Complexed With ACE-Ala-Ala-Pro-Ala-7-Amino-4-Methylcoumarin
16	PDB:1e3bA	0.904	0.930	2.817E-24	172	0.520	0.535	1e3bA.pdb.gz	First Crystal Structure of a Medicinally Relevant Gold Protein Complex:Unexpected Binding of [Au(Pet (3))](+) to Histidine
17	PDB:4n1mA	0.899	0.947	7.843E-24	168	0.520	0.548	4n1mA.pdb.gz	Mapping the binding surface of Cyclophilin A.
18	PDB:3iciA	0.908	0.860	1.309E-23	187	0.537	0.508	3iciA.pdb.gz	Structural Basis of Cyclophilin B Binding by the Calnexin/Calreticulin P-domain.
19	PDB:5yzg3	0.908	0.938	1.552E-23	171	0.514	0.532	5yzg3.pdb.gz	Structure of a human catalytic step I spliceosome
20	PDB:7wffj	0.901	0.922	1.105E-21	173	0.537	0.549	7wffj.pdb.gz	Supramolecular assembly of chloroplast NADH dehydrogenase-like complex with photosystem I from Arabidopsis thaliana.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43447	3.51e-130	363	177	1.000	1.000	PPIH_HUMAN Peptidyl-prolyl cis-trans isomerase H OS=Homo sapiens OX=9606 GN=PPIH PE=1 SV=1
2	Q6TLD7	3.00e-118	333	177	0.876	0.876	Q6TLD7_DANRE Peptidyl-prolyl cis-trans isomerase OS=Danio rerio OX=7955 GN=zgc:136730 PE=1 SV=1
3	Q7ZVQ9	8.40e-102	292	181	0.768	0.751	Q7ZVQ9_DANRE Peptidyl-prolyl cis-trans isomerase OS=Danio rerio OX=7955 GN=zgc:136730 PE=1 SV=1
4	Q4V5H1	1.31e-101	291	183	0.757	0.732	Q4V5H1_DROME Peptidyl-prolyl cis-trans isomerase OS=Drosophila melanogaster OX=7227 GN=Dmel\CG17266 PE=1 SV=1
5	Q9ZVJ4	3.50e-92	268	199	0.712	0.633	CYP22_ARATH Peptidyl-prolyl cis-trans isomerase CYP22 OS=Arabidopsis thaliana OX=3702 GN=CYP22 PE=2 SV=1
6	Q8I6S4	2.28e-74	224	217	0.582	0.475	Q8I6S4_PLAF7 Peptidyl-prolyl cis-trans isomerase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0804800 PE=3 SV=1
7	O74729	3.22e-73	219	173	0.593	0.607	PPIH_SCHPO Peptidyl-prolyl cis-trans isomerase cyp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cyp3 PE=3 SV=1
8	G8XQW2	1.71e-67	205	173	0.554	0.566	G8XQW2_GOSHI Peptidyl-prolyl cis-trans isomerase OS=Gossypium hirsutum OX=3635 GN=LOC107916701 PE=2 SV=1
9	Q54SM3	9.12e-67	203	179	0.571	0.564	PPIA_DICDI Peptidyl-prolyl cis-trans isomerase A OS=Dictyostelium discoideum OX=44689 GN=ppiA PE=1 SV=1
10	Q38867	1.91e-65	200	176	0.565	0.568	CP19C_ARATH Peptidyl-prolyl cis-trans isomerase CYP19-3 OS=Arabidopsis thaliana OX=3702 GN=CYP19-3 PE=2 SV=2
11	P21568	2.30e-65	199	171	0.559	0.579	CYPH_SOLLC Peptidyl-prolyl cis-trans isomerase OS=Solanum lycopersicum OX=4081 GN=CYP PE=1 SV=1
12	Q38900	2.57e-65	199	173	0.542	0.555	CP19A_ARATH Peptidyl-prolyl cis-trans isomerase CYP19-1 OS=Arabidopsis thaliana OX=3702 GN=CYP19-1 PE=1 SV=1
13	Q39613	5.00e-65	199	172	0.542	0.558	CYPH_CATRO Peptidyl-prolyl cis-trans isomerase OS=Catharanthus roseus OX=4058 GN=PCKR1 PE=1 SV=1
14	Q9SKQ0	6.08e-65	198	174	0.537	0.546	CP19B_ARATH Peptidyl-prolyl cis-trans isomerase CYP19-2 OS=Arabidopsis thaliana OX=3702 GN=CYP19-2 PE=2 SV=1
15	P34791	1.78e-63	197	260	0.537	0.365	CP20C_ARATH Peptidyl-prolyl cis-trans isomerase CYP20-3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CYP20-3 PE=1 SV=1
16	E1BXG9	2.29e-63	201	370	0.576	0.276	E1BXG9_CHICK Peptidylprolyl isomerase D OS=Gallus gallus OX=9031 GN=PPID PE=1 SV=2
17	E3TF51	6.52e-63	193	164	0.554	0.598	E3TF51_ICTPU Peptidyl-prolyl cis-trans isomerase OS=Ictalurus punctatus OX=7998 GN=PPIA PE=2 SV=1
18	P29117	7.50e-63	194	206	0.565	0.485	PPIF_RAT Peptidyl-prolyl cis-trans isomerase F, mitochondrial OS=Rattus norvegicus OX=10116 GN=Ppif PE=1 SV=2
19	Q99KR7	1.29e-62	194	206	0.565	0.485	PPIF_MOUSE Peptidyl-prolyl cis-trans isomerase F, mitochondrial OS=Mus musculus OX=10090 GN=Ppif PE=1 SV=1
20	Q9CR16	1.31e-62	199	370	0.588	0.281	PPID_MOUSE Peptidyl-prolyl cis-trans isomerase D OS=Mus musculus OX=10090 GN=Ppid PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00160 Pro_isomerase	6.5e-46	167.9	Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008841051.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008831767.1	0.997	pre-mRNA processing factor 4
2	1026970.XP_008841973.1	0.997	pre-mRNA processing factor 3
3	1026970.XP_008825960.1	0.993	pre-mRNA processing factor 31
4	1026970.XP_008843015.1	0.993	SNU13 homolog, small nuclear ribonucleoprotein (U4/U6.U5)
5	1026970.XP_008836433.1	0.969	Elongation factor Tu GTP binding domain containing 2
6	1026970.XP_008841538.1	0.968	pre-mRNA-processing factor 6 isoform X1
7	1026970.XP_008853159.1	0.963	LSM3 homolog, U6 small nuclear RNA and mRNA degradation associated
8	1026970.XP_008827006.1	0.956	pre-mRNA-processing-splicing factor 8
9	1026970.XP_008836334.1	0.956	U5 small nuclear ribonucleoprotein 200 kDa helicase
10	1026970.XP_008836103.1	0.947	Small nuclear ribonucleoprotein Sm D3
11	1026970.XP_008822774.1	0.946	LSM4 homolog, U6 small nuclear RNA and mRNA degradation associated
12	1026970.XP_008825198.1	0.942	Small nuclear ribonucleoprotein F-like
13	1026970.XP_008830289.1	0.942	Small nuclear ribonucleoprotein F
14	1026970.XP_008825190.1	0.940	Small nuclear ribonucleoprotein D1 polypeptide
15	1026970.XP_008819728.1	0.928	LSM2 homolog, U6 small nuclear RNA and mRNA degradation associated
16	1026970.XP_008850270.1	0.927	Small nuclear ribonucleoprotein Sm D2
17	1026970.XP_008835395.1	0.923	LSM8 homolog, U6 small nuclear RNA associated
18	1026970.XP_008820502.1	0.918	Squamous cell carcinoma antigen recognized by T-cells 1
19	1026970.XP_008852993.1	0.915	Protein phosphatase 1 regulatory subunit 42
20	1026970.XP_008821469.1	0.914	Small nuclear ribonucleoprotein G

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003755	1.000	peptidyl-prolyl cis-trans isomerase activity
GO:0005515	0.997	protein binding
GO:0016018	0.992	cyclosporin A binding
GO:0044877	0.356	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.979	cellular process
GO:0044237	0.972	cellular metabolic process
GO:0006807	0.970	nitrogen compound metabolic process
GO:0000377	0.946	RNA splicing, via transesterification reactions with bulged adenosine as nucleophile
GO:0006397	0.941	mRNA processing
GO:0000398	0.895	mRNA splicing, via spliceosome
GO:0050789	0.535	regulation of biological process
GO:0071840	0.427	cellular component organization or biogenesis
GO:0050794	0.310	regulation of cellular process
GO:0016043	0.304	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005737	0.998	cytoplasm
GO:0032991	0.993	protein-containing complex
GO:0005634	0.985	nucleus
GO:0005681	0.974	spliceosomal complex
GO:0031981	0.928	nuclear lumen
GO:0005829	0.918	cytosol
GO:0005654	0.877	nucleoplasm
GO:0120114	0.858	Sm-like protein family complex
GO:0030532	0.820	small nuclear ribonucleoprotein complex
GO:0097525	0.792	spliceosomal snRNP complex
GO:0071011	0.595	precatalytic spliceosome
GO:0016604	0.486	nuclear body
GO:0097526	0.425	spliceosomal tri-snRNP complex
GO:1902494	0.351	catalytic complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:16237	1.000	[protein]-peptidylproline (omega=180) = [protein]-peptidylproline (omega=0)
EC:5.2.1.8	1.000	peptidylprolyl isomerase.

[back to server]