StarFunc result for job id O43451

User Input

>input (1857 residues)
MARKKLKKFTTLEIVLSVLLLVLFIISIVLIVLLAKESLKSTAPDPGTTGTPDPGTTGTP
DPGTTGTTHARTTGPPDPGTTGTTPVSAECPVVNELERINCIPDQPPTKATCDQRGCCWN
PQGAVSVPWCYYSKNHSYHVEGNLVNTNAGFTARLKNLPSSPVFGSNVDNVLLTAEYQTS
NRFHFKLTDQTNNRFEVPHEHVQSFSGNAAASLTYQVEISRQPFSIKVTRRSNNRVLFDS
SIGPLLFADQFLQLSTRLPSTNVYGLGEHVHQQYRHDMNWKTWPIFNRDTTPNGNGTNLY
GAQTFFLCLEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTIGGILDFYVFLGNTPEQVV
QEYLELIGRPALPSYWALGFHLSRYEYGTLDNMREVVERNRAAQLPYDVQHADIDYMDER
RDFTYDSVDFKGFPEFVNELHNNGQKLVIIVDPAISNNSSSSKPYGPYDRGSDMKIWVNS
SDGVTPLIGEVWPGQTVFPDYTNPNCAVWWTKEFELFHNQVEFDGIWIDMNEVSNFVDGS
VSGCSTNNLNNPPFTPRILDGYLFCKTLCMDAVQHWGKQYDIHNLYGYSMAVATAEAAKT
VFPNKRSFILTRSTFAGSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICG
FALDTPEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGADSLLLNSSRHYLNIRYTLL
PYLYTLFFRAHSRGDTVARPLLHEFYEDNSTWDVHQQFLWGPGLLITPVLDEGAEKVMAY
VPDAVWYDYETGSQVRWRKQKVEMELPGDKIGLHLRGGYIFPTQQPNTTTLASRKNPLGL
IIALDENKEAKGELFWDNGETKDTVANKVYLLCEFSVTQNRLEVNISQSTYKDPNNLAFN
EIKILGTEEPSNVTVKHNGVPSQTSPTVTYDSNLKVAIITDIDLLLGEAYTVEWSIKIRD
EEKIDCYPDENGASAENCTARGCIWEASNSSGVPFCYFVNDLYSVSDVQYNSHGATADIS
LKSSVYANAFPSTPVNPLRLDVTYHKNEMLQFKIYDPNKNRYEVPVPLNIPSMPSSTPEG
QLYDVLIKKNPFGIEIRRKSTGTIIWDSQLLGFTFSDMFIRISTRLPSKYLYGFGETEHR
SYRRDLEWHTWGMFSRDQPPGYKKNSYGVHPYYMGLEEDGSAHGVLLLNSNAMDVTFQPL
PALTYRTTGGVLDFYVFLGPTPELVTQQYTELIGRPVMVPYWSLGFQLCRYGYQNDSEIA
SLYDEMVAAQIPYDVQYSDIDYMERQLDFTLSPKFAGFPALINRMKADGMRVILILDPAI
SGNETQPYPAFTRGVEDDVFIKYPNDGDIVWGKVWPDFPDVVVNGSLDWDSQVELYRAYV
AFPDFFRNSTAKWWKREIEELYNNPQNPERSLKFDGMWIDMNEPSSFVNGAVSPGCRDAS
LNHPPYMPHLESRDRGLSSKTLCMESQQILPDGSLVQHYNVHNLYGWSQTRPTYEAVQEV
TGQRGVVITRSTFPSSGRWAGHWLGDNTAAWDQLKKSIIGMMEFSLFGISYTGADICGFF
QDAEYEMCVRWMQLGAFYPFSRNHNTIGTRRQDPVSWDVAFVNISRTVLQTRYTLLPYLY
TLMHKAHTEGVTVVRPLLHEFVSDQVTWDIDSQFLLGPAFLVSPVLERNARNVTAYFPRA
RWYDYYTGVDINARGEWKTLPAPLDHINLHVRGGYILPWQEPALNTHLSRQKFMGFKIAL
DDEGTAGGWLFWDDGQSIDTYGKGLYYLASFSASQNTMQSHIIFNNYITGTNPLKLGYIE
IWGVGSVPVTSVSISVSGMVITPSFNNDPTTQVLSIDVTDRNISLHNFTSLTWISTL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0J9YVE6	0.546	0.828	0.000	1200	0.481	0.745	A0A0J9YVE6.pdb.gz	A0A0J9YVE6_MOUSE Maltase-glucoamylase OS=Mus musculus OX=10090 GN=Mgam PE=1 SV=1
2	AFDB:F8VQM5	0.715	0.727	0.000	1818	0.583	0.596	F8VQM5.pdb.gz	F8VQM5_MOUSE Sucrase isomaltase (alpha-glucosidase) OS=Mus musculus OX=10090 GN=Sis PE=1 SV=1
3	AFDB:O43451	1.000	1.000	0.000	1857	1.000	1.000	O43451.pdb.gz	MGA_HUMAN Maltase-glucoamylase OS=Homo sapiens OX=9606 GN=MGAM PE=1 SV=6
4	AFDB:P10253	0.447	0.864	0.000	952	0.213	0.416	P10253.pdb.gz	LYAG_HUMAN Lysosomal alpha-glucosidase OS=Homo sapiens OX=9606 GN=GAA PE=1 SV=4
5	AFDB:P14410	0.583	0.591	0.000	1827	0.581	0.591	P14410.pdb.gz	SUIS_HUMAN Sucrase-isomaltase, intestinal OS=Homo sapiens OX=9606 GN=SI PE=1 SV=6
6	AFDB:P23739	0.823	0.829	0.000	1841	0.568	0.573	P23739.pdb.gz	SUIS_RAT Sucrase-isomaltase, intestinal OS=Rattus norvegicus OX=10116 GN=Si PE=1 SV=5
7	AFDB:P70699	0.447	0.865	0.000	953	0.219	0.426	P70699.pdb.gz	LYAG_MOUSE Lysosomal alpha-glucosidase OS=Mus musculus OX=10090 GN=Gaa PE=1 SV=2
8	AFDB:Q2M2H8	0.674	0.524	0.000	2515	0.644	0.476	Q2M2H8.pdb.gz	MGAL_HUMAN Probable maltase-glucoamylase 2 OS=Homo sapiens OX=9606 GN=MGAM2 PE=2 SV=3
9	PDB:5kzwA	0.443	0.960	9.085E-104	850	0.205	0.447	5kzwA.pdb.gz	The structure of human GAA: structural basis of Pompe disease
10	AFDB:Q19004	0.444	0.869	8.001E-91	936	0.184	0.364	Q19004.pdb.gz	Q19004_CAEEL P-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=aagr-1 PE=1 SV=2
11	AFDB:Q21750	0.439	0.840	9.350E-91	955	0.179	0.348	Q21750.pdb.gz	Q21750_CAEEL P-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=aagr-2 PE=1 SV=3
12	PDB:5iefA	0.398	0.849	1.454E-68	858	0.125	0.272	5iefA.pdb.gz	Structures of mammalian ER alpha-glucosidase II capture the binding modes of broad-spectrum iminosugar antivirals.
13	PDB:5npbA	0.373	0.857	7.857E-52	780	0.085	0.203	5npbA.pdb.gz	1,6-Cyclophellitol Cyclosulfates: A New Class of Irreversible Glycosidase Inhibitor.
14	PDB:2f2hA	0.346	0.792	7.958E-44	773	0.087	0.208	2f2hA.pdb.gz	Expanding the Thioglycoligase Strategy to the Synthesis of alpha-linked Thioglycosides Allows Structural Investigation of the Parent Enzyme/Substrate Complex
15	PDB:5jovA	0.329	0.621	1.184E-42	949	0.090	0.177	5jovA.pdb.gz	Structural dissection of a complex Bacteroides ovatus gene locus conferring xyloglucan metabolism in the human gut.
16	PDB:6druA	0.293	0.714	6.107E-35	718	0.073	0.188	6druA.pdb.gz	Crystal Structure of alpha-Xylosidase fromAspergillus nigerin Complex with a Hydrolyzed Xyloglucan Product and New Insights in Accurately Predicting Substrate Specificities of GH31 Family Glycosidases.
17	PDB:5aedA	0.265	0.691	3.960E-34	674	0.066	0.182	5aedA.pdb.gz	Yihq is a Sulfoquinovosidase that Cleaves Sulfoquinovosyl Diacylglyceride Sulfolipids.
18	PDB:4fnsA	0.207	0.455	5.343E-13	718	0.049	0.127	4fnsA.pdb.gz	The molecular mechanism of the thermostable alpha-galactosidases AgaA and AgaB explained by X-ray crystallography and mutational studies
19	PDB:2xn2A	0.201	0.439	1.732E-11	729	0.051	0.130	2xn2A.pdb.gz	Crystal Structure of Alpha-Galactosidase from Lactobacillus Acidophilus Ncfm: Insight Into Tetramer Formation and Substrate Binding.
20	PDB:5m1iA	0.173	0.490	3.403E-11	539	0.038	0.132	5m1iA.pdb.gz	Structural Snapshots for Mechanism-Based Inactivation of a Glycoside Hydrolase by Cyclopropyl Carbasugars.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0J9YVE6	0.0	1895	1200	0.482	0.747	A0A0J9YVE6_MOUSE Maltase-glucoamylase OS=Mus musculus OX=10090 GN=Mgam PE=1 SV=1
2	A0A0J9YVJ0	0.0	1731	986	0.434	0.817	A0A0J9YVJ0_MOUSE Maltase-glucoamylase (Fragment) OS=Mus musculus OX=10090 GN=Mgam PE=1 SV=1
3	A0A571BF69	0.0	2253	3616	0.602	0.309	A0A571BF69_MOUSE Maltase-glucoamylase OS=Mus musculus OX=10090 GN=Mgam PE=1 SV=1
4	B5THE2	0.0	3075	1827	0.789	0.802	B5THE2_MOUSE Maltase-glucoamylase OS=Mus musculus OX=10090 GN=Mgam PE=1 SV=1
5	B5THE3	0.0	2310	1818	0.585	0.598	B5THE3_MOUSE Sucrase-isomaltase OS=Mus musculus OX=10090 GN=Sis PE=2 SV=1
6	F8VQM5	0.0	2311	1818	0.585	0.598	F8VQM5_MOUSE Sucrase isomaltase (alpha-glucosidase) OS=Mus musculus OX=10090 GN=Sis PE=1 SV=1
7	O43451	0.0	2721	2753	0.724	0.488	MGA_HUMAN Maltase-glucoamylase OS=Homo sapiens OX=9606 GN=MGAM PE=1 SV=6
8	P10253	0.0	626	952	0.193	0.377	LYAG_HUMAN Lysosomal alpha-glucosidase OS=Homo sapiens OX=9606 GN=GAA PE=1 SV=4
9	P14410	0.0	2316	1827	0.586	0.596	SUIS_HUMAN Sucrase-isomaltase, intestinal OS=Homo sapiens OX=9606 GN=SI PE=1 SV=6
10	P23739	0.0	2160	1841	0.565	0.570	SUIS_RAT Sucrase-isomaltase, intestinal OS=Rattus norvegicus OX=10116 GN=Si PE=1 SV=5
11	P70699	0.0	640	953	0.193	0.377	LYAG_MOUSE Lysosomal alpha-glucosidase OS=Mus musculus OX=10090 GN=Gaa PE=1 SV=2
12	Q2M2H8	0.0	2501	2515	0.639	0.472	MGAL_HUMAN Probable maltase-glucoamylase 2 OS=Homo sapiens OX=9606 GN=MGAM2 PE=2 SV=3
13	Q6P7A9	0.0	638	953	0.195	0.380	LYAG_RAT Lysosomal alpha-glucosidase OS=Rattus norvegicus OX=10116 GN=Gaa PE=2 SV=1
14	Q6XK24	0.0	851	536	0.226	0.784	Q6XK24_MOUSE Membrane-bound maltase-glucoamylase (Fragment) OS=Mus musculus OX=10090 GN=Mgam PE=2 SV=1
15	Q19004	7.95e-179	568	936	0.177	0.350	Q19004_CAEEL P-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=aagr-1 PE=1 SV=2
16	Q21750	1.46e-170	546	955	0.184	0.357	Q21750_CAEEL P-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=aagr-2 PE=1 SV=3
17	Q6XK23	1.35e-169	519	316	0.129	0.756	Q6XK23_MOUSE Maltase-glucoamylase (Fragment) OS=Mus musculus OX=10090 GN=Mgam PE=1 SV=1
18	Q9LYF8	1.17e-163	526	902	0.165	0.339	Q9LYF8_ARATH AT5g11720/T22P22_110 OS=Arabidopsis thaliana OX=3702 GN=AGLU1 PE=1 SV=1
19	O04931	6.62e-157	508	913	0.174	0.355	AGLU_BETVU Alpha-glucosidase OS=Beta vulgaris OX=161934 PE=1 SV=1
20	F4J6T7	6.82e-137	451	868	0.153	0.328	XYL2_ARATH Putative alpha-xylosidase 2 OS=Arabidopsis thaliana OX=3702 GN=XYL2 PE=5 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13802 Gal_mutarotas_2	3.2e-09	48.3	Galactose mutarotase-like
2	PF01055 Glyco_hydro_31	0	1039.5	Glycosyl hydrolases family 31
3	PF16863 NtCtMGAM_N	1.7e-62	220.0	N-terminal barrel of NtMGAM and CtMGAM, maltase-glucoamylase
4	PF00088 Trefoil	2.6e-17	73.7	Trefoil (P-type) domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000447378

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000481450	0.982	Pancreatic alpha-amylase
2	9606.ENSP00000218516	0.965	Galactosidase alpha
3	9606.ENSP00000294724	0.965	Glycogen debranching enzyme
4	9606.ENSP00000330484	0.963	Belongs to the glycosyl hydrolase 13 family
5	9606.ENSP00000354610	0.962	Amylase, alpha 2B
6	9606.ENSP00000410833	0.943	1,4-alpha-glucan-branching enzyme
7	9606.ENSP00000216962	0.935	Glycogen phosphorylase, brain form
8	9606.ENSP00000216392	0.933	Glycogen phosphorylase, liver form
9	9606.ENSP00000164139	0.931	Glycogen phosphorylase, muscle form
10	9606.ENSP00000326227	0.924	Neutral alpha-glucosidase C
11	9606.ENSP00000264382	0.907	Sucrase-isomaltase, intestinal
12	9606.ENSP00000305692	0.907	Lysosomal alpha-glucosidase
13	9606.ENSP00000447431	0.901	Probable maltase-glucoamylase 2
14	9606.ENSP00000353731	0.879	Dipeptidyl peptidase 4
15	9606.ENSP00000380432	0.858	Insulin
16	9606.ENSP00000266086	0.809	Solute carrier family 5 member 4
17	9606.ENSP00000327943	0.805	Sodium/glucose cotransporter 2
18	9606.ENSP00000387662	0.804	Glucagon
19	9606.ENSP00000233616	0.738	Mannosyl-oligosaccharide glucosidase
20	9606.ENSP00000292432	0.733	Catalyzes the phosphorylation of hexose, such as D-glucose and D-fructose, to hexose 6-phosphate (D-glucose 6-phosphate and D- fructose 6-phosphate, respectively) . Mediates the initial step of glycolysis by catalyzing phosphorylation of D-glucose to D-glucose 6-phosphate .

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004558	1.000	alpha-1,4-glucosidase activity
GO:0005515	0.982	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.997	primary metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0044262	0.979	cellular carbohydrate metabolic process
GO:0044275	0.965	cellular carbohydrate catabolic process
GO:0044042	0.922	glucan metabolic process
GO:0009251	0.787	glucan catabolic process
GO:0044247	0.769	cellular polysaccharide catabolic process
GO:0006073	0.765	cellular glucan metabolic process
GO:0009311	0.759	oligosaccharide metabolic process
GO:0009313	0.717	oligosaccharide catabolic process
GO:0005984	0.714	disaccharide metabolic process
GO:0046352	0.696	disaccharide catabolic process
GO:0005982	0.540	starch metabolic process
GO:0050896	0.403	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0012505	0.991	endomembrane system
GO:0005622	0.977	intracellular anatomical structure
GO:0043227	0.971	membrane-bounded organelle
GO:0043229	0.970	intracellular organelle
GO:0005576	0.960	extracellular region
GO:0005737	0.960	cytoplasm
GO:0043231	0.960	intracellular membrane-bounded organelle
GO:0005886	0.942	plasma membrane
GO:0031982	0.861	vesicle
GO:0005615	0.832	extracellular space
GO:0031410	0.828	cytoplasmic vesicle
GO:0070062	0.810	extracellular exosome
GO:0099503	0.686	secretory vesicle
GO:0030141	0.618	secretory granule
GO:0031090	0.563	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.2.1.20	1.000	alpha-glucosidase.

[back to server]