StarFunc result for job id O43462

User Input

>input (519 residues)
MIPVSLVVVVVGGWTVVYLTDLVLKSSVYFKHSYEDWLENNGLSISPFHIRWQTAVFNRA
FYSWGRRKARMLYQWFNFGMVFGVIAMFSSFFLLGKTLMQTLAQMMADSPSSYSSSSSSS
SSSSSSSSSSSSSSSSLHNEQVLQVVVPGINLPVNQLTYFFTAVLISGVVHEIGHGIAAI
REQVRFNGFGIFLFIIYPGAFVDLFTTHLQLISPVQQLRIFCAGIWHNFVLALLGILALV
LLPVILLPFYYTGVGVLITEVAEDSPAIGPRGLFVGDLVTHLQDCPVTNVQDWNECLDTI
AYEPQIGYCISASTLQQLSFPVRAYKRLDGSTECCNNHSLTDVCFSYRNNFNKRLHTCLP
ARKAVEATQVCRTNKDCKKSSSSSFCIIPSLETHTRLIKVKHPPQIDMLYVGHPLHLHYT
VSITSFIPRFNFLSIDLPVVVETFVKYLISLSGALAIVNAVPCFALDGQWILNSFLDATL
TSVIGDNDVKDLIGFFILLGGSVLLAANVTLGLWMVTAR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43462	1.000	1.000	1.567E-92	519	1.000	1.000	O43462.pdb.gz	MBTP2_HUMAN Membrane-bound transcription factor site-2 protease OS=Homo sapiens OX=9606 GN=MBTPS2 PE=1 SV=1
2	AFDB:F1R4A6	0.926	0.972	6.100E-70	494	0.601	0.632	F1R4A6.pdb.gz
3	AFDB:F4JUU5	0.690	0.697	1.533E-28	513	0.218	0.220	F4JUU5.pdb.gz	S2P_ARATH Membrane-bound transcription factor site-2 protease homolog OS=Arabidopsis thaliana OX=3702 GN=S2P PE=2 SV=2
4	PDB:7w6xA	0.275	0.314	1.704E-5	447	0.135	0.157	7w6xA.pdb.gz	Mechanistic insights into intramembrane proteolysis by E. coli site-2 protease homolog RseP.
5	AFDB:P36583	0.087	0.054	2.229E-1	1016	0.092	0.047	P36583.pdb.gz	PCK2_SCHPO Protein kinase C-like 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pck2 PE=1 SV=2
6	PDB:7st9G	0.074	0.099	3.232E-1	340	0.031	0.047	7st9G.pdb.gz	Mechanisms of loading and release of the 9-1-1 checkpoint clamp.
7	PDB:7y1rB	0.052	0.071	4.195E-1	308	0.031	0.052	7y1rB.pdb.gz
8	PDB:8dtlA	0.060	0.045	5.444E-1	741	0.027	0.019	8dtlA.pdb.gz
9	PDB:7nqkA	0.103	0.085	6.042E-1	658	0.064	0.050	7nqkA.pdb.gz
10	PDB:4jj0A	0.049	0.133	7.840E-1	181	0.025	0.072	4jj0A.pdb.gz	Structural insight into magnetochrome-mediated magnetite biomineralization.
11	PDB:7jxgA	0.060	0.115	7.840E-1	178	0.035	0.101	7jxgA.pdb.gz	A Model for the Solution Structure of Human Fe(II)-Bound Acireductone Dioxygenase and Interactions with the Regulatory Domain of Matrix Metalloproteinase I (MMP-I).
12	AFDB:Q70GP4	0.089	0.050	1.122	1148	0.081	0.037	Q70GP4.pdb.gz	STATB_DICDI Signal transducer and activator of transcription B OS=Dictyostelium discoideum OX=44689 GN=dstB PE=1 SV=1
13	PDB:6drtA	0.054	0.099	1.129	230	0.025	0.057	6drtA.pdb.gz	T4 DNA ligase structure reveals a prototypical ATP-dependent ligase with a unique mode of sliding clamp interaction.
14	PDB:1ucuA	0.098	0.101	1.253	494	0.133	0.140	1ucuA.pdb.gz
15	PDB:2qhfA	0.056	0.068	1.253	392	0.052	0.069	2qhfA.pdb.gz	Mycobacterium tuberculosis Chorismate synthase in complex with NCA
16	AFDB:A0A2R8QN30	0.057	0.094	2.866	228	0.042	0.096	A0A2R8QN30.pdb.gz	A0A2R8QN30_DANRE Myelin protein P0 isoform X1 OS=Danio rerio OX=7955 GN=p0 PE=1 SV=1
17	AFDB:Q8CIS0	0.084	0.044	3.530	1159	0.031	0.014	Q8CIS0.pdb.gz	CAR11_MOUSE Caspase recruitment domain-containing protein 11 OS=Mus musculus OX=10090 GN=Card11 PE=1 SV=2
18	AFDB:Q57VI0	0.055	0.042	4.128	768	0.050	0.034	Q57VI0.pdb.gz	Q57VI0_TRYB2 Serine/threonine-protein kinase PLK OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.2F2.640 PE=3 SV=1
19	AFDB:A0A494C1N2	0.082	0.050	4.349	1013	0.029	0.015	A0A494C1N2.pdb.gz	A0A494C1N2_HUMAN Caspase recruitment domain family member 14 OS=Homo sapiens OX=9606 GN=CARD14 PE=1 SV=1
20	AFDB:P40534	0.078	0.063	4.349	656	0.027	0.021	P40534.pdb.gz	PRM2_YEAST Pheromone-regulated membrane protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRM2 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43462	0.0	1061	519	1.000	1.000	MBTP2_HUMAN Membrane-bound transcription factor site-2 protease OS=Homo sapiens OX=9606 GN=MBTPS2 PE=1 SV=1
2	O54862	0.0	1025	510	0.965	0.982	MBTP2_CRIGR Membrane-bound transcription factor site-2 protease OS=Cricetulus griseus OX=10029 GN=MBTPS2 PE=2 SV=1
3	Q4V9P5	0.0	656	494	0.603	0.634	Q4V9P5_DANRE Membrane-bound transcription factor site-2 protease OS=Danio rerio OX=7955 GN=wu:fk47a09 PE=1 SV=1
4	Q8CHX6	0.0	1031	515	0.967	0.975	MBTP2_MOUSE Membrane-bound transcription factor site-2 protease OS=Mus musculus OX=10090 GN=Mbtps2 PE=2 SV=1
5	F4JUU5	1.40e-27	118	513	0.216	0.218	S2P_ARATH Membrane-bound transcription factor site-2 protease homolog OS=Arabidopsis thaliana OX=3702 GN=S2P PE=2 SV=2
6	Q8TDM6	0.27	36.6	1919	0.033	0.009	DLG5_HUMAN Disks large homolog 5 OS=Homo sapiens OX=9606 GN=DLG5 PE=1 SV=4
7	E9Q9R9	0.37	36.2	1921	0.029	0.008	DLG5_MOUSE Disks large homolog 5 OS=Mus musculus OX=10090 GN=Dlg5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13180 PDZ_2	19	17.0	PDZ domain
2	PF02163 Peptidase_M50	4.2e-37	139.7	Peptidase family M50

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000368798

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354476	0.983	Sterol regulatory element-binding protein 2
2	9606.ENSP00000356919	0.976	Cyclic AMP-dependent transcription factor ATF-6 alpha
3	9606.ENSP00000348069	0.973	Sterol regulatory element-binding protein 1
4	9606.ENSP00000078445	0.971	Cyclic AMP-responsive element-binding protein 3-like protein 3
5	9606.ENSP00000481956	0.966	Cyclic AMP-responsive element-binding protein 3-like protein 1
6	9606.ENSP00000329140	0.961	Cyclic AMP-responsive element-binding protein 3-like protein 2
7	9606.ENSP00000344223	0.961	Membrane-bound transcription factor site-1 protease
8	9606.ENSP00000342136	0.958	Cyclic AMP-responsive element-binding protein 3
9	9606.ENSP00000357596	0.957	Cyclic AMP-responsive element-binding protein 3-like protein 4
10	9606.ENSP00000265565	0.844	Sterol regulatory element-binding protein cleavage-activating protein
11	9606.ENSP00000381237	0.757	Histocompatibility minor 13
12	9606.ENSP00000216037	0.709	X-box-binding protein 1
13	9606.ENSP00000366395	0.705	E3 ubiquitin-protein ligase synoviolin
14	9606.ENSP00000256497	0.689	ER degradation-enhancing alpha-mannosidase-like protein 1
15	9606.ENSP00000364349	0.673	Cyclic AMP-dependent transcription factor ATF-6 beta
16	9606.ENSP00000363824	0.671	Trimeric intracellular cation channel type B
17	9606.ENSP00000401445	0.667	Serine/threonine-protein kinase/endoribonuclease IRE1
18	9606.ENSP00000372059	0.665	Interferon-induced transmembrane protein 5
19	9606.ENSP00000296015	0.637	Belongs to the TTC14 family
20	9606.ENSP00000323696	0.621	Cartilage-associated protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004222	1.000	metalloendopeptidase activity
GO:0005488	0.386	binding
GO:0005515	0.374	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.998	organic substance metabolic process
GO:0009987	0.997	cellular process
GO:0044238	0.997	primary metabolic process
GO:0050896	0.996	response to stimulus
GO:0050794	0.996	regulation of cellular process
GO:0051716	0.992	cellular response to stimulus
GO:0033619	0.992	membrane protein proteolysis
GO:0080090	0.991	regulation of primary metabolic process
GO:0006950	0.990	response to stress
GO:0009889	0.990	regulation of biosynthetic process
GO:0031323	0.990	regulation of cellular metabolic process
GO:0031326	0.984	regulation of cellular biosynthetic process
GO:0034976	0.949	response to endoplasmic reticulum stress
GO:0009893	0.942	positive regulation of metabolic process
GO:0048522	0.935	positive regulation of cellular process
GO:0009891	0.928	positive regulation of biosynthetic process
GO:0031328	0.921	positive regulation of cellular biosynthetic process
GO:0051171	0.911	regulation of nitrogen compound metabolic process
GO:0010468	0.904	regulation of gene expression
GO:0051173	0.891	positive regulation of nitrogen compound metabolic process
GO:0010604	0.879	positive regulation of macromolecule metabolic process
GO:0006355	0.878	regulation of DNA-templated transcription
GO:0006357	0.831	regulation of transcription by RNA polymerase II
GO:0065009	0.828	regulation of molecular function
GO:0045944	0.817	positive regulation of transcription by RNA polymerase II
GO:0036003	0.790	positive regulation of transcription from RNA polymerase II promoter in response to stress
GO:0044093	0.449	positive regulation of molecular function
GO:0051090	0.383	regulation of DNA-binding transcription factor activity
GO:0044237	0.364	cellular metabolic process
GO:0042221	0.354	response to chemical
GO:0007154	0.328	cell communication
GO:0023052	0.327	signaling
GO:0010033	0.325	response to organic substance
GO:0007165	0.322	signal transduction
GO:0032502	0.301	developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000139	1.000	Golgi membrane
GO:0005783	0.974	endoplasmic reticulum
GO:0042175	0.956	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0005789	0.952	endoplasmic reticulum membrane
GO:0070013	0.511	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.24.-	1.000	Metalloendopeptidases.

[back to server]