StarFunc result for job id O43463

User Input

>input (412 residues)
MAENLKGCSVCCKSSWNQLQDLCRLAKLSCPALGISKRNLYDFEVEYLCDYKKIREQEYY
LVKWRGYPDSESTWEPRQNLKCVRILKQFHKDLERELLRRHHRSKTPRHLDPSLANYLVQ
KAKQRRALRRWEQELNAKRSHLGRITVENEVDLDGPPRAFVYINEYRVGEGITLNQVAVG
CECQDCLWAPTGGCCPGASLHKFAYNDQGQVRLRAGLPIYECNSRCRCGYDCPNRVVQKG
IRYDLCIFRTDDGRGWGVRTLEKIRKNSFVMEYVGEIITSEEAERRGQIYDRQGATYLFD
LDYVEDVYTVDAAYYGNISHFVNHSCDPNLQVYNVFIDNLDERLPRIAFFATRTIRAGEE
LTFDYNMQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIECKCGTESCRKYLF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B1H256	0.979	0.979	3.335E-83	412	0.959	0.959	B1H256.pdb.gz	B1H256_RAT Histone-lysine N-methyltransferase OS=Rattus norvegicus OX=10116 GN=Suv39h1 PE=3 SV=1
2	AFDB:A0A2R8QCU6	0.954	0.913	2.270E-69	431	0.684	0.654	A0A2R8QCU6.pdb.gz
3	AFDB:Q6DGD3	0.884	0.886	8.416E-65	411	0.626	0.628	Q6DGD3.pdb.gz	SV91A_DANRE Histone-lysine N-methyltransferase SUV39H1-A OS=Danio rerio OX=7955 GN=suv39h1a PE=2 SV=2
4	AFDB:Q9EQQ0	0.900	0.780	2.270E-63	477	0.573	0.495	Q9EQQ0.pdb.gz	SUV92_MOUSE Histone-lysine N-methyltransferase SUV39H2 OS=Mus musculus OX=10090 GN=Suv39h2 PE=1 SV=1
5	AFDB:Q9H5I1	0.883	0.887	3.120E-60	410	0.590	0.593	Q9H5I1.pdb.gz	SUV92_HUMAN Histone-lysine N-methyltransferase SUV39H2 OS=Homo sapiens OX=9606 GN=SUV39H2 PE=1 SV=2
6	AFDB:P45975	0.644	0.423	9.101E-39	635	0.371	0.241	P45975.pdb.gz	SUV39_DROME Histone-lysine N-methyltransferase Su(var)3-9 OS=Drosophila melanogaster OX=7227 GN=Su(var)3-9 PE=1 SV=2
7	AFDB:O60016	0.609	0.519	5.959E-29	490	0.337	0.284	O60016.pdb.gz	CLR4_SCHPO Histone-lysine N-methyltransferase, H3 lysine-9 specific OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=clr4 PE=1 SV=2
8	AFDB:O64827	0.544	0.170	1.326E-23	1382	0.216	0.064	O64827.pdb.gz	SUVR5_ARATH Histone-lysine N-methyltransferase SUVR5 OS=Arabidopsis thaliana OX=3702 GN=SUVR5 PE=1 SV=3
9	AFDB:C8VT24	0.542	0.411	8.934E-23	551	0.257	0.192	C8VT24.pdb.gz	C8VT24_EMENI Histone-lysine N-methyltransferase Clr4 (AFU_orthologue AFUA_1G11090) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_01170 PE=4 SV=1
10	AFDB:Q53H47	0.530	0.325	2.839E-22	684	0.223	0.135	Q53H47.pdb.gz	SETMR_HUMAN Histone-lysine N-methyltransferase SETMAR OS=Homo sapiens OX=9606 GN=SETMAR PE=1 SV=2
11	PDB:1pegA	0.529	0.803	1.987E-20	266	0.238	0.368	1pegA.pdb.gz	Structural basis for the product specificity of histone lysine methyltransferases
12	PDB:5wg6A	0.322	0.260	4.509E-13	517	0.143	0.114	5wg6A.pdb.gz	An Evolutionarily Conserved Structural Platform for PRC2 Inhibition by a Class of Ezh2 Inhibitors.
13	PDB:5hynA	0.339	0.245	7.586E-13	581	0.148	0.105	5hynA.pdb.gz	Structural basis of oncogenic histone H3K27M inhibition of human polycomb repressive complex 2.
14	PDB:7ksoA	0.340	0.353	1.704E-12	395	0.155	0.162	7ksoA.pdb.gz	Structures of monomeric and dimeric PRC2:EZH1 reveal flexible modules involved in chromatin compaction.
15	PDB:6wkrC	0.329	0.227	3.218E-12	606	0.155	0.106	6wkrC.pdb.gz	JARID2 and AEBP2 regulate PRC2 in the presence of H2AK119ub1 and other histone modifications.
16	PDB:7td5A	0.319	0.266	8.598E-12	497	0.160	0.133	7td5A.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
17	PDB:7td5F	0.346	0.321	8.598E-12	447	0.192	0.177	7td5F.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
18	PDB:5h6zA	0.236	0.707	7.231E-6	123	0.078	0.260	5h6zA.pdb.gz
19	PDB:2g46A	0.184	0.554	7.444E-3	119	0.063	0.218	2g46A.pdb.gz	Structural insights of the specificity and catalysis of a viral histone H3 lysine 27 methyltransferase.
20	PDB:5v3hA	0.117	0.110	1.252E-2	438	0.034	0.032	5v3hA.pdb.gz	Small molecule inhibitors and CRISPR/Cas9 mutagenesis demonstrate that SMYD2 and SMYD3 activity are dispensable for autonomous cancer cell proliferation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZJE7	0.0	549	286	0.636	0.916	A0A8I5ZJE7_RAT Histone-lysine N-methyltransferase OS=Rattus norvegicus OX=10116 GN=Suv39h1 PE=3 SV=1
2	A0A8I6A0U8	0.0	811	438	0.944	0.888	A0A8I6A0U8_RAT Histone-lysine N-methyltransferase OS=Rattus norvegicus OX=10116 GN=Suv39h1 PE=3 SV=1
3	A0A8I6A3A4	0.0	753	445	0.893	0.827	A0A8I6A3A4_RAT Histone-lysine N-methyltransferase OS=Rattus norvegicus OX=10116 GN=Suv39h1 PE=3 SV=1
4	A0A8I6AJD7	0.0	813	414	0.944	0.940	A0A8I6AJD7_RAT Histone-lysine N-methyltransferase OS=Rattus norvegicus OX=10116 GN=Suv39h1 PE=3 SV=1
5	B0S6M0	0.0	615	421	0.701	0.686	B0S6M0_DANRE Histone-lysine N-methyltransferase OS=Danio rerio OX=7955 GN=fe47h06 PE=1 SV=1
6	B1H256	0.0	823	412	0.959	0.959	B1H256_RAT Histone-lysine N-methyltransferase OS=Rattus norvegicus OX=10116 GN=Suv39h1 PE=3 SV=1
7	O43463	0.0	856	412	1.000	1.000	SUV91_HUMAN Histone-lysine N-methyltransferase SUV39H1 OS=Homo sapiens OX=9606 GN=SUV39H1 PE=1 SV=1
8	O54864	0.0	822	412	0.954	0.954	SUV91_MOUSE Histone-lysine N-methyltransferase SUV39H1 OS=Mus musculus OX=10090 GN=Suv39h1 PE=1 SV=1
9	Q6DGD3	0.0	547	411	0.626	0.628	SV91A_DANRE Histone-lysine N-methyltransferase SUV39H1-A OS=Danio rerio OX=7955 GN=suv39h1a PE=2 SV=2
10	Q9H5I1	3.06e-172	489	410	0.585	0.588	SUV92_HUMAN Histone-lysine N-methyltransferase SUV39H2 OS=Homo sapiens OX=9606 GN=SUV39H2 PE=1 SV=2
11	Q9EQQ0	6.36e-168	481	477	0.575	0.497	SUV92_MOUSE Histone-lysine N-methyltransferase SUV39H2 OS=Mus musculus OX=10090 GN=Suv39h2 PE=1 SV=1
12	P45975	2.86e-63	216	635	0.371	0.241	SUV39_DROME Histone-lysine N-methyltransferase Su(var)3-9 OS=Drosophila melanogaster OX=7227 GN=Su(var)3-9 PE=1 SV=2
13	O60016	4.46e-55	191	490	0.279	0.235	CLR4_SCHPO Histone-lysine N-methyltransferase, H3 lysine-9 specific OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=clr4 PE=1 SV=2
14	Q5DW34	5.32e-40	154	1296	0.187	0.059	EHMT1_MOUSE Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus OX=10090 GN=Ehmt1 PE=1 SV=2
15	D4A005	5.61e-40	154	1285	0.187	0.060	D4A005_RAT Euchromatic histone lysine methyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Ehmt1 PE=1 SV=4
16	A0A0G2K889	5.85e-40	154	1302	0.187	0.059	A0A0G2K889_RAT Euchromatic histone lysine methyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Ehmt1 PE=1 SV=2
17	A0A8I6ABS0	5.87e-40	154	1243	0.187	0.062	A0A8I6ABS0_RAT Euchromatic histone lysine methyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Ehmt1 PE=1 SV=1
18	A0A8I6AB09	6.13e-40	154	1302	0.187	0.059	A0A8I6AB09_RAT Euchromatic histone lysine methyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Ehmt1 PE=1 SV=1
19	A0A8I6ANQ0	6.15e-40	154	1276	0.187	0.060	A0A8I6ANQ0_RAT Euchromatic histone lysine methyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Ehmt1 PE=1 SV=1
20	Q9H9B1	1.16e-39	153	1298	0.187	0.059	EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens OX=9606 GN=EHMT1 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00385 Chromo	1.1e-10	52.6	Chromo (CHRromatin Organisation MOdifier) domain
2	PF05033 Pre-SET	1.1e-13	63.1	Pre-SET motif
3	PF00856 SET	7.6e-22	90.0	SET domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000009389

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000001750	0.966	Chromobox homolog 5
2	60711.ENSCSAP00000015496	0.922	Chromobox homolog 1
3	60711.ENSCSAP00000003766	0.900	Sirtuin 1
4	60711.ENSCSAP00000003647	0.859	DNA (cytosine-5-)-methyltransferase 1
5	60711.ENSCSAP00000000691	0.839	Ribosomal RNA processing 8, methyltransferase, homolog (yeast)
6	60711.ENSCSAP00000017790	0.834	Belongs to the histone H3 family.
7	60711.ENSCSAP00000007551	0.828	Acts as a tumor suppressor in many tumor types
8	60711.ENSCSAP00000008720	0.816	DNA (cytosine-5-)-methyltransferase 3 beta
9	60711.ENSCSAP00000002685	0.814	Damage-specific DNA binding protein 1, 127kDa
10	60711.ENSCSAP00000002114	0.802	F-box and leucine-rich repeat protein 19
11	60711.ENSCSAP00000013762	0.789	RB transcriptional corepressor 1
12	60711.ENSCSAP00000003568	0.786	Chromodomain protein, Y-like
13	60711.ENSCSAP00000014412	0.786	annotation not available
14	60711.ENSCSAP00000014471	0.786	Chromodomain protein, Y-like 2
15	60711.ENSCSAP00000014557	0.778	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events
16	60711.ENSCSAP00000009491	0.776	Uncharacterized protein
17	60711.ENSCSAP00000006705	0.763	B-cell CLL/lymphoma 11B (zinc finger protein)
18	60711.ENSCSAP00000011772	0.761	Histone deacetylase 2
19	60711.ENSCSAP00000001252	0.759	Induces fibroblasts to differentiate into myoblasts. Acts as a transcriptional activator that promotes transcription of muscle- specific target genes and plays a role in muscle differentiation.
20	60711.ENSCSAP00000017082	0.759	E2F transcription factor 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0046974	1.000	histone H3K9 methyltransferase activity
GO:0097159	0.982	organic cyclic compound binding
GO:1901363	0.980	heterocyclic compound binding
GO:0003676	0.973	nucleic acid binding
GO:0003682	0.970	chromatin binding
GO:0003677	0.945	DNA binding
GO:0003690	0.833	double-stranded DNA binding
GO:0043565	0.797	sequence-specific DNA binding
GO:0001067	0.715	transcription regulatory region nucleic acid binding
GO:1990837	0.709	sequence-specific double-stranded DNA binding
GO:0000976	0.659	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0009987	0.962	cellular process
GO:0009605	0.954	response to external stimulus
GO:0042221	0.944	response to chemical
GO:0031667	0.939	response to nutrient levels
GO:0050794	0.885	regulation of cellular process
GO:0019222	0.878	regulation of metabolic process
GO:0071840	0.873	cellular component organization or biogenesis
GO:0060255	0.871	regulation of macromolecule metabolic process
GO:0080090	0.858	regulation of primary metabolic process
GO:0051171	0.858	regulation of nitrogen compound metabolic process
GO:0016043	0.857	cellular component organization
GO:0031323	0.857	regulation of cellular metabolic process
GO:0048519	0.853	negative regulation of biological process
GO:0010468	0.809	regulation of gene expression
GO:0048523	0.795	negative regulation of cellular process
GO:0010556	0.795	regulation of macromolecule biosynthetic process
GO:0019219	0.787	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.780	regulation of cellular biosynthetic process
GO:0009892	0.779	negative regulation of metabolic process
GO:0006325	0.758	chromatin organization
GO:0051172	0.743	negative regulation of nitrogen compound metabolic process
GO:1903506	0.741	regulation of nucleic acid-templated transcription
GO:0010605	0.735	negative regulation of macromolecule metabolic process
GO:0006355	0.734	regulation of DNA-templated transcription
GO:0009890	0.728	negative regulation of biosynthetic process
GO:0006996	0.726	organelle organization
GO:0031324	0.724	negative regulation of cellular metabolic process
GO:0010558	0.717	negative regulation of macromolecule biosynthetic process
GO:0045934	0.712	negative regulation of nucleobase-containing compound metabolic process
GO:0010629	0.705	negative regulation of gene expression
GO:0031327	0.688	negative regulation of cellular biosynthetic process
GO:0010033	0.676	response to organic substance
GO:1903507	0.660	negative regulation of nucleic acid-templated transcription
GO:0048518	0.650	positive regulation of biological process
GO:0048522	0.606	positive regulation of cellular process
GO:0071704	0.538	organic substance metabolic process
GO:0044238	0.534	primary metabolic process
GO:0006807	0.532	nitrogen compound metabolic process
GO:0043170	0.531	macromolecule metabolic process
GO:0001975	0.522	response to amphetamine
GO:0045892	0.518	negative regulation of DNA-templated transcription
GO:0032501	0.512	multicellular organismal process
GO:0051716	0.504	cellular response to stimulus
GO:0009893	0.488	positive regulation of metabolic process
GO:0010604	0.441	positive regulation of macromolecule metabolic process
GO:0019538	0.440	protein metabolic process
GO:0044237	0.439	cellular metabolic process
GO:0044260	0.425	cellular macromolecule metabolic process
GO:0043412	0.415	macromolecule modification
GO:0036211	0.413	protein modification process
GO:0051173	0.402	positive regulation of nitrogen compound metabolic process
GO:0031325	0.399	positive regulation of cellular metabolic process
GO:0051276	0.392	chromosome organization
GO:0006950	0.380	response to stress
GO:0032502	0.368	developmental process
GO:0048856	0.355	anatomical structure development
GO:0006338	0.314	chromatin remodeling
GO:0016570	0.304	histone modification

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0000785	1.000	chromatin
GO:0031981	0.998	nuclear lumen
GO:0005654	0.993	nucleoplasm
GO:0000792	0.990	heterochromatin
GO:0005677	0.984	chromatin silencing complex
GO:0000228	0.966	nuclear chromosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:51736	1.000	L-lysyl-[protein] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl-[protein] + S-adenosyl-L-homocysteine

[back to server]