StarFunc result for job id O43474

User Input

>input (513 residues)
MRQPPGESDMAVSDALLPSFSTFASGPAGREKTLRQAGAPNNRWREELSHMKRLPPVLPG
RPYDLAAATVATDLESGGAGAACGGSNLAPLPRRETEEFNDLLDLDFILSNSLTHPPESV
AATVSSSASASSSSSPSSSGPASAPSTCSFTYPIRAGNDPGVAPGGTGGGLLYGRESAPP
PTAPFNLADINDVSPSGGFVAELLRPELDPVYIPPQQPQPPGGGLMGKFVLKASLSAPGS
EYGSPSVISVSKGSPDGSHPVVVAPYNGGPPRTCPKIKQEAVSSCTHLGAGPPLSNGHRP
AAHDFPLGRQLPSRTTPTLGLEEVLSSRDCHPALPLPPGFHPHPGPNYPSFLPDQMQPQV
PPLHYQGQSRGFVARAGEPCVCWPHFGTHGMMLTPPSSPLELMPPGSCMPEEPKPKRGRR
SWPRKRTATHTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTRH
YRKHTGHRPFQCQKCDRAFSRSDHLALHMKRHF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43474	1.000	1.000	2.254E-76	513	1.000	1.000	O43474.pdb.gz	KLF4_HUMAN Krueppel-like factor 4 OS=Homo sapiens OX=9606 GN=KLF4 PE=1 SV=3
2	AFDB:Q60793	0.379	0.400	1.333E-57	483	0.854	0.907	Q60793.pdb.gz	KLF4_MOUSE Krueppel-like factor 4 OS=Mus musculus OX=10090 GN=Klf4 PE=1 SV=3
3	AFDB:A0A0A0MT54	0.175	0.172	5.008E-10	522	0.226	0.222	A0A0A0MT54.pdb.gz	A0A0A0MT54_HUMAN Wilms tumor protein OS=Homo sapiens OX=9606 GN=WT1 PE=1 SV=2
4	AFDB:Q02086	0.169	0.142	3.377E-8	613	0.228	0.191	Q02086.pdb.gz	SP2_HUMAN Transcription factor Sp2 OS=Homo sapiens OX=9606 GN=SP2 PE=1 SV=3
5	AFDB:Q01714	0.162	0.107	5.209E-8	786	0.242	0.158	Q01714.pdb.gz	SP1_RAT Transcription factor Sp1 OS=Rattus norvegicus OX=10116 GN=Sp1 PE=1 SV=2
6	AFDB:Q5BIH1	0.162	0.105	6.201E-7	803	0.230	0.147	Q5BIH1.pdb.gz	Q5BIH1_DROME RE58581p OS=Drosophila melanogaster OX=7227 GN=klu PE=2 SV=1
7	AFDB:Q09838	0.155	0.117	2.276E-6	681	0.222	0.167	Q09838.pdb.gz	PRZ1_SCHPO Transcriptional regulator prz1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=prz1 PE=1 SV=1
8	AFDB:Q10RP4	0.126	0.046	2.422E-6	1487	0.183	0.063	Q10RP4.pdb.gz	SE14_ORYSJ Probable lysine-specific demethylase SE14 OS=Oryza sativa subsp. japonica OX=39947 GN=SE14 PE=3 SV=2
9	AFDB:M9NEG1	0.162	0.079	2.916E-6	1109	0.218	0.101	M9NEG1.pdb.gz	M9NEG1_DROME Maternal gene required for meiosis, isoform F OS=Drosophila melanogaster OX=7227 GN=mamo PE=4 SV=1
10	AFDB:Q4WJ81	0.147	0.102	5.417E-6	754	0.240	0.163	Q4WJ81.pdb.gz	CRZA_ASPFU C2H2 finger domain transcription factor crzA OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=crzA PE=1 SV=1
11	PDB:7nac7	0.043	0.132	5.493	129	0.025	0.101	7nac7.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
12	PDB:5a4pA	0.042	0.078	7.037	227	0.012	0.026	5a4pA.pdb.gz
13	PDB:7drtB	0.047	0.048	9.015	496	0.012	0.012	7drtB.pdb.gz	Cryo-EM structure of human Wntless in complex with Wnt3a.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZW83	0.0	740	509	0.854	0.861	A0A8I5ZW83_RAT Kruppel like factor 4 OS=Rattus norvegicus OX=10116 GN=Klf4 PE=4 SV=1
2	A0A8I6B336	0.0	741	481	0.852	0.909	A0A8I6B336_RAT Kruppel like factor 4 OS=Rattus norvegicus OX=10116 GN=Klf4 PE=4 SV=1
3	O43474	0.0	1036	513	1.000	1.000	KLF4_HUMAN Krueppel-like factor 4 OS=Homo sapiens OX=9606 GN=KLF4 PE=1 SV=3
4	Q60793	0.0	748	483	0.854	0.907	KLF4_MOUSE Krueppel-like factor 4 OS=Mus musculus OX=10090 GN=Klf4 PE=1 SV=3
5	Q923V7	0.0	745	482	0.856	0.911	Q923V7_RAT Kruppel like factor 4 OS=Rattus norvegicus OX=10116 GN=Klf4 PE=1 SV=1
6	A9X6Q5	8.28e-113	341	396	0.442	0.573	A9X6Q5_DANRE Krueppel-like factor 4 OS=Danio rerio OX=7955 GN=klf4a PE=2 SV=1
7	Q90XE7	5.57e-74	240	363	0.376	0.532	Q90XE7_DANRE Klf2b protein OS=Danio rerio OX=7955 GN=cb125 PE=2 SV=1
8	Q1LXI7	6.17e-72	235	380	0.361	0.487	Q1LXI7_DANRE Krueppel-like factor 2 OS=Danio rerio OX=7955 GN=etID35223.22 PE=4 SV=1
9	Q9DFS2	3.24e-69	229	409	0.357	0.447	Q9DFS2_DANRE Biklf OS=Danio rerio OX=7955 GN=klf4 PE=2 SV=1
10	Q9Y5W3	1.26e-67	223	355	0.205	0.296	KLF2_HUMAN Krueppel-like factor 2 OS=Homo sapiens OX=9606 GN=KLF2 PE=1 SV=2
11	Q9ET58	1.85e-66	220	351	0.201	0.293	KLF2_RAT Krueppel-like factor 2 OS=Rattus norvegicus OX=10116 GN=Klf2 PE=1 SV=1
12	Q60843	1.14e-65	218	354	0.199	0.288	KLF2_MOUSE Krueppel-like factor 2 OS=Mus musculus OX=10090 GN=Klf2 PE=1 SV=2
13	Q13351	1.44e-52	184	362	0.160	0.227	KLF1_HUMAN Krueppel-like factor 1 OS=Homo sapiens OX=9606 GN=KLF1 PE=1 SV=1
14	B0BNN2	8.53e-50	177	368	0.154	0.215	B0BNN2_RAT Klf1 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Klf1 PE=2 SV=1
15	A0A8I5ZPH7	3.55e-49	175	361	0.154	0.219	A0A8I5ZPH7_RAT Kruppel like factor 1 OS=Rattus norvegicus OX=10116 GN=Klf1 PE=4 SV=1
16	G3V6F3	9.44e-49	174	396	0.154	0.199	G3V6F3_RAT Kruppel like factor 1 OS=Rattus norvegicus OX=10116 GN=Klf1 PE=4 SV=2
17	Q90XE6	1.36e-48	173	365	0.148	0.208	KLF1_DANRE Kruppel-like factor 1 OS=Danio rerio OX=7955 GN=klf1 PE=2 SV=1
18	P46099	2.52e-48	172	358	0.152	0.218	KLF1_MOUSE Krueppel-like factor 1 OS=Mus musculus OX=10090 GN=Klf1 PE=1 SV=2
19	Q66HP1	2.70e-45	164	363	0.140	0.198	Q66HP1_RAT Klf5 protein OS=Rattus norvegicus OX=10116 GN=Klf5 PE=2 SV=1
20	Q9Z0Z7	5.05e-45	166	446	0.144	0.166	KLF5_MOUSE Krueppel-like factor 5 OS=Mus musculus OX=10090 GN=Klf5 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16159 FOXP-CC	7.3e+02	12.1	FOXP coiled-coil domain
2	PF00096 zf-C2H2	1.1e-12	58.8	Zinc finger, C2H2 type
3	PF13894 zf-C2H2_4	0.0002	32.9	C2H2-type zinc finger
4	PF15909 zf-C2H2_8	7.8e+02	11.8	C2H2-type zinc ribbon
5	PF13465 zf-H2C2_2	8.4e-07	40.4	Zinc-finger double domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000000095

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000008032	0.977	E1A binding protein p300
2	9593.ENSGGOP00000001814	0.938	Catenin beta 1
3	9593.ENSGGOP00000005899	0.937	CREB binding protein
4	9593.ENSGGOP00000024325	0.906	SRY-box 1
5	9593.ENSGGOP00000022447	0.852	POU domain protein
6	9593.ENSGGOP00000005320	0.848	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes
7	9593.ENSGGOP00000009561	0.845	Cellular tumor antigen p53
8	9593.ENSGGOP00000018597	0.839	Lin-28 homolog A (C. elegans)
9	9593.ENSGGOP00000018583	0.837	MYC proto-oncogene, bHLH transcription factor
10	9593.ENSGGOP00000022094	0.806	Uncharacterized protein
11	9593.ENSGGOP00000002204	0.747	Estrogen-related receptor beta
12	9593.ENSGGOP00000024387	0.732	CCAAT/enhancer binding protein (C/EBP), beta
13	9593.ENSGGOP00000020538	0.712	Signal transducer and activator of transcription 3 (acute-phase response factor)
14	9593.ENSGGOP00000011454	0.707	Histone deacetylase 1
15	9593.ENSGGOP00000004720	0.705	Fibroblast growth factor 2 (basic)
16	9593.ENSGGOP00000001317	0.699	Estrogen-related receptor alpha
17	9593.ENSGGOP00000023042	0.695	Uncharacterized protein
18	9593.ENSGGOP00000024709	0.695	Uncharacterized protein
19	9593.ENSGGOP00000028185	0.695	Uncharacterized protein
20	9593.ENSGGOP00000016583	0.687	Serpin family A member 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0001228	1.000	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000978	0.997	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0140297	0.995	DNA-binding transcription factor binding
GO:0061629	0.954	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0003682	0.946	chromatin binding
GO:1990841	0.894	promoter-specific chromatin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.990	regulation of biological process
GO:0009987	0.986	cellular process
GO:0050794	0.974	regulation of cellular process
GO:0060255	0.958	regulation of macromolecule metabolic process
GO:0006355	0.949	regulation of DNA-templated transcription
GO:0050896	0.922	response to stimulus
GO:0051254	0.915	positive regulation of RNA metabolic process
GO:0010557	0.914	positive regulation of macromolecule biosynthetic process
GO:0042127	0.913	regulation of cell population proliferation
GO:0006357	0.907	regulation of transcription by RNA polymerase II
GO:0051716	0.895	cellular response to stimulus
GO:0031328	0.895	positive regulation of cellular biosynthetic process
GO:0045893	0.894	positive regulation of DNA-templated transcription
GO:0048523	0.890	negative regulation of cellular process
GO:0010033	0.850	response to organic substance
GO:0032501	0.844	multicellular organismal process
GO:0045944	0.840	positive regulation of transcription by RNA polymerase II
GO:0032502	0.826	developmental process
GO:0048856	0.812	anatomical structure development
GO:0071310	0.809	cellular response to organic substance
GO:0008152	0.790	metabolic process
GO:0009719	0.783	response to endogenous stimulus
GO:0071704	0.774	organic substance metabolic process
GO:1901700	0.736	response to oxygen-containing compound
GO:0006950	0.727	response to stress
GO:0071495	0.709	cellular response to endogenous stimulus
GO:0065009	0.708	regulation of molecular function
GO:0044237	0.684	cellular metabolic process
GO:0007275	0.666	multicellular organism development
GO:0048869	0.636	cellular developmental process
GO:0051239	0.626	regulation of multicellular organismal process
GO:0030154	0.618	cell differentiation
GO:0010628	0.610	positive regulation of gene expression
GO:0048513	0.603	animal organ development
GO:0031324	0.603	negative regulation of cellular metabolic process
GO:0050793	0.594	regulation of developmental process
GO:0008285	0.564	negative regulation of cell population proliferation
GO:2000026	0.516	regulation of multicellular organismal development
GO:0051172	0.502	negative regulation of nitrogen compound metabolic process
GO:0010605	0.482	negative regulation of macromolecule metabolic process
GO:0033993	0.480	response to lipid
GO:0044238	0.462	primary metabolic process
GO:0045892	0.417	negative regulation of DNA-templated transcription
GO:0048583	0.406	regulation of response to stimulus
GO:0048731	0.405	system development
GO:0033554	0.401	cellular response to stress
GO:0010629	0.357	negative regulation of gene expression
GO:0051094	0.354	positive regulation of developmental process
GO:0051240	0.349	positive regulation of multicellular organismal process
GO:0009653	0.330	anatomical structure morphogenesis
GO:0032526	0.325	response to retinoic acid
GO:1901701	0.314	cellular response to oxygen-containing compound
GO:0009888	0.311	tissue development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000785	1.000	chromatin
GO:0005654	0.997	nucleoplasm
GO:0032991	0.973	protein-containing complex
GO:0005737	0.959	cytoplasm
GO:0005667	0.844	transcription regulator complex
GO:0005829	0.587	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]