StarFunc result for job id O43488

User Input

>input (359 residues)
MLSAASRVVSRAAVHCALRSPPPEARALAMSRPPPPRVASVLGTMEMGRRMDAPASAAAV
RAFLERGHTELDTAFMYSDGQSETILGGLGLGLGGGDCRVKIATKANPWDGKSLKPDSVR
SQLETSLKRLQCPQVDLFYLHAPDHGTPVEETLHACQRLHQEGKFVELGLSNYASWEVAE
ICTLCKSNGWILPTVYQGMYNATTRQVETELFPCLRHFGLRFYAYNPLAGGLLTGKYKYE
DKDGKQPVGRFFGNSWAETYRNRFWKEHHFEAIALVEKALQAAYGASAPSVTSAALRWMY
HHSQLQGAHGDAVILGMSSLEQLEQNLAATEEGPLEPAVVDAFNQAWHLVAHECPNYFR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43488	1.000	1.000	4.536E-74	359	1.000	1.000	O43488.pdb.gz	ARK72_HUMAN Aflatoxin B1 aldehyde reductase member 2 OS=Homo sapiens OX=9606 GN=AKR7A2 PE=1 SV=3
2	AFDB:Q8CG45	0.904	0.884	1.273E-66	367	0.877	0.858	Q8CG45.pdb.gz	ARK72_RAT Aflatoxin B1 aldehyde reductase member 2 OS=Rattus norvegicus OX=10116 GN=Akr7a2 PE=1 SV=2
3	AFDB:A0A384MDN8	0.907	0.984	5.194E-63	331	0.808	0.876	A0A384MDN8.pdb.gz	A0A384MDN8_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
4	PDB:2c91A	0.901	0.996	4.056E-60	325	0.816	0.902	2c91A.pdb.gz	Crystal Structure of Mouse Succinic Semialdehyde Reductase Akr7A5: Structural Basis for Substrate Specificity.
5	PDB:2clpA	0.896	0.995	7.255E-60	323	0.805	0.895	2clpA.pdb.gz	Crystal Structure of Human Aflatoxin B1 Aldehyde Reductase Member 3
6	AFDB:P38918	0.901	0.989	3.789E-59	327	0.713	0.783	P38918.pdb.gz	ARK73_RAT Aflatoxin B1 aldehyde reductase member 3 OS=Rattus norvegicus OX=10116 GN=Akr7a3 PE=1 SV=2
7	PDB:1gveA	0.897	0.994	8.235E-57	324	0.713	0.790	1gveA.pdb.gz	The Crystal Structure of Rat Liver Akr7A1: A Dimeric Member of the Aldo-Keto Reductase Superfamily
8	PDB:1gveB	0.826	0.984	1.235E-51	301	0.677	0.807	1gveB.pdb.gz	The Crystal Structure of Rat Liver Akr7A1: A Dimeric Member of the Aldo-Keto Reductase Superfamily
9	AFDB:P0A9T4	0.768	0.796	2.190E-22	346	0.212	0.220	P0A9T4.pdb.gz	TAS_ECOLI Protein tas OS=Escherichia coli (strain K12) OX=83333 GN=tas PE=1 SV=1
10	PDB:1lqaA	0.765	0.792	5.413E-22	346	0.206	0.214	1lqaA.pdb.gz	Crystal structure of the Escherichia coli Tas protein, an NADP(H)-dependent aldo-keto reductase
11	AFDB:P62482	0.754	0.739	1.776E-21	367	0.245	0.240	P62482.pdb.gz	KCAB2_MOUSE Voltage-gated potassium channel subunit beta-2 OS=Mus musculus OX=10090 GN=Kcnab2 PE=1 SV=1
12	AFDB:P77735	0.701	0.772	2.668E-21	324	0.234	0.259	P77735.pdb.gz	YAJO_ECOLI 1-deoxyxylulose-5-phosphate synthase YajO OS=Escherichia coli (strain K12) OX=83333 GN=yajO PE=1 SV=2
13	AFDB:Q14722	0.752	0.650	3.176E-21	419	0.220	0.189	Q14722.pdb.gz	KCAB1_HUMAN Voltage-gated potassium channel subunit beta-1 OS=Homo sapiens OX=9606 GN=KCNAB1 PE=1 SV=1
14	AFDB:Q8VZ23	0.745	0.657	5.680E-21	412	0.259	0.226	Q8VZ23.pdb.gz	Q8VZ23_ARATH NAD(P)-linked oxidoreductase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At1g04420 PE=1 SV=1
15	PDB:2a79A	0.750	0.820	6.594E-21	326	0.223	0.245	2a79A.pdb.gz	Crystal structure of a mammalian voltage-dependent Shaker family K+ channel.
16	AFDB:O23016	0.754	0.821	6.762E-21	328	0.223	0.244	O23016.pdb.gz	KCAB_ARATH Probable voltage-gated potassium channel subunit beta OS=Arabidopsis thaliana OX=3702 GN=KAB1 PE=1 SV=1
17	PDB:4aubB	0.703	0.749	2.369E-20	335	0.237	0.254	4aubB.pdb.gz	The Diversity of Microbial Aldo/Keto Reductases from Escherichia Coli K12.
18	PDB:4astD	0.669	0.772	5.597E-18	308	0.223	0.260	4astD.pdb.gz
19	PDB:3h7rA	0.577	0.667	5.656E-15	307	0.181	0.212	3h7rA.pdb.gz	Characterization of two novel aldo-keto reductases from Arabidopsis: expression patterns, broad substrate specificity, and an open active-site structure suggest a role in toxicant metabolism following stress.
20	PDB:4gacA	0.575	0.629	9.006E-15	324	0.189	0.210	4gacA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A384MDN8	0.0	589	331	0.808	0.876	A0A384MDN8_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
2	O43488	0.0	748	359	1.000	1.000	ARK72_HUMAN Aflatoxin B1 aldehyde reductase member 2 OS=Homo sapiens OX=9606 GN=AKR7A2 PE=1 SV=3
3	O95154	0.0	589	331	0.808	0.876	ARK73_HUMAN Aflatoxin B1 aldehyde reductase member 3 OS=Homo sapiens OX=9606 GN=AKR7A3 PE=1 SV=2
4	P38918	0.0	534	327	0.713	0.783	ARK73_RAT Aflatoxin B1 aldehyde reductase member 3 OS=Rattus norvegicus OX=10116 GN=Akr7a3 PE=1 SV=2
5	Q8CG45	0.0	629	367	0.880	0.861	ARK72_RAT Aflatoxin B1 aldehyde reductase member 2 OS=Rattus norvegicus OX=10116 GN=Akr7a2 PE=1 SV=2
6	Q8CG76	0.0	623	367	0.883	0.864	ARK72_MOUSE Aflatoxin B1 aldehyde reductase member 2 OS=Mus musculus OX=10090 GN=Akr7a2 PE=1 SV=3
7	Q8NHP1	0.0	620	331	0.822	0.891	ARK74_HUMAN Aflatoxin B1 aldehyde reductase member 4 OS=Homo sapiens OX=9606 GN=AKR7L PE=2 SV=7
8	V9HWA2	0.0	748	359	1.000	1.000	V9HWA2_HUMAN Aldo-keto reductase family 7, member A2 (Aflatoxin aldehyde reductase) OS=Homo sapiens OX=9606 GN=HEL-S-166mP PE=2 SV=1
9	H7C5H7	1.87e-76	236	205	0.351	0.615	H7C5H7_HUMAN Aldo-keto reductase family 7 member A2 (Fragment) OS=Homo sapiens OX=9606 GN=AKR7A2 PE=1 SV=1
10	O23016	9.05e-24	102	328	0.248	0.271	KCAB_ARATH Probable voltage-gated potassium channel subunit beta OS=Arabidopsis thaliana OX=3702 GN=KAB1 PE=1 SV=1
11	O59826	1.94e-20	93.2	344	0.240	0.250	KCAB_SCHPO Putative voltage-gated potassium channel subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC965.06 PE=3 SV=1
12	Q01752	7.26e-19	89.0	385	0.240	0.223	AAD_PHACH Aryl-alcohol dehydrogenase [NADP(+)] OS=Phanerodontia chrysosporium OX=2822231 PE=1 SV=1
13	P62482	1.32e-18	88.2	367	0.223	0.218	KCAB2_MOUSE Voltage-gated potassium channel subunit beta-2 OS=Mus musculus OX=10090 GN=Kcnab2 PE=1 SV=1
14	P62483	1.32e-18	88.2	367	0.223	0.218	KCAB2_RAT Voltage-gated potassium channel subunit beta-2 OS=Rattus norvegicus OX=10116 GN=Kcnab2 PE=1 SV=1
15	H0YWU3	5.66e-18	86.7	398	0.220	0.198	H0YWU3_TAEGU Voltage-gated potassium channel subunit beta-2 OS=Taeniopygia guttata OX=59729 GN=KCNAB2 PE=3 SV=1
16	P42884	7.30e-18	85.9	376	0.242	0.231	AAD14_YEAST Putative aryl-alcohol dehydrogenase AAD14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AAD14 PE=1 SV=1
17	C8VQ93	7.66e-18	86.3	398	0.198	0.178	AUSK_EMENI Aldo-keto reductase ausK OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ausK PE=3 SV=1
18	Q93ZN2	1.65e-17	84.7	345	0.240	0.249	ALKR4_ARATH Probable aldo-keto reductase 4 OS=Arabidopsis thaliana OX=3702 GN=At1g60710 PE=2 SV=1
19	Q13303	2.85e-17	84.3	367	0.212	0.207	KCAB2_HUMAN Voltage-gated potassium channel subunit beta-2 OS=Homo sapiens OX=9606 GN=KCNAB2 PE=1 SV=2
20	P77735	2.91e-17	83.6	324	0.220	0.244	YAJO_ECOLI 1-deoxyxylulose-5-phosphate synthase YajO OS=Escherichia coli (strain K12) OX=83333 GN=yajO PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00248 Aldo_ket_red	8.2e-46	168.0	Aldo/keto reductase family
2	PF15685 GGN	1.2e+02	13.0	Gametogenetin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000235835

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355377	0.987	Aflatoxin B1 aldehyde reductase member 3
2	9606.ENSP00000380252	0.928	Nuclear factor erythroid 2-related factor 2
3	9606.ENSP00000360266	0.917	Transcription factor AP-1
4	9606.ENSP00000387699	0.901	Cyclic AMP-responsive element-binding protein 1
5	9606.ENSP00000292079	0.900	Sodium/potassium-transporting ATPase subunit gamma
6	9606.ENSP00000306245	0.900	Proto-oncogene c-Fos
7	9606.ENSP00000361140	0.836	Alcohol dehydrogenase [NADP(+)]
8	9606.ENSP00000285930	0.719	Aldose reductase
9	9606.ENSP00000428585	0.708	Small integral membrane protein 12
10	9606.ENSP00000261332	0.705	Zinc finger protein 24
11	9606.ENSP00000340279	0.692	Afadin- and alpha-actinin-binding protein
12	9606.ENSP00000451000	0.689	Zinc finger and BTB domain-containing protein 1
13	9606.ENSP00000352584	0.687	Aldo-keto reductase family 1 member B10
14	9606.ENSP00000349016	0.671	Peroxisomal membrane protein PEX14
15	9606.ENSP00000392330	0.668	B-cell receptor-associated protein 31
16	9606.ENSP00000364320	0.649	mRNA turnover protein 4 homolog
17	9606.ENSP00000478104	0.644	Vacuolar protein sorting 13 homolog D
18	9606.ENSP00000387941	0.642	Intermediate filament family orphan 2
19	9606.ENSP00000369927	0.637	Aldo-keto reductase family 1 member C3
20	9606.ENSP00000211314	0.630	Transmembrane protein 14A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0009055	0.998	electron transfer activity
GO:0004032	0.998	alditol:NADP+ 1-oxidoreductase activity
GO:0005515	0.996	protein binding
GO:0042802	0.306	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006081	0.997	cellular aldehyde metabolic process
GO:0044281	0.770	small molecule metabolic process
GO:1901360	0.727	organic cyclic compound metabolic process
GO:0044238	0.659	primary metabolic process
GO:0065007	0.538	biological regulation
GO:0006807	0.537	nitrogen compound metabolic process
GO:0019748	0.366	secondary metabolic process
GO:0006725	0.331	cellular aromatic compound metabolic process
GO:0050896	0.326	response to stimulus
GO:0050789	0.326	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.995	endomembrane system
GO:0005576	0.987	extracellular region
GO:0031982	0.930	vesicle
GO:0070062	0.916	extracellular exosome
GO:0005794	0.898	Golgi apparatus
GO:0070013	0.809	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:12789	0.998	an alditol + NADP(+) = an aldose + H(+) + NADPH
EC:1.1.1.21	0.998	aldose reductase.

[back to server]