StarFunc result for job id O43491

User Input

>input (1005 residues)
MTTEVGSVSEVKKDSSQLGTDATKEKPKEVAENQQNQSSDPEEEKGSQPPPAAESQSSLR
RQKREKETSESRGISRFIPPWLKKQKSYTLVVAKDGGDKKEPTQAVVEEQVLDKEEPLPE
EQRQAKGDAEEMAQKKQEIKVEVKEEKPSVSKEEKPSVSKVEMQPTELVSKEREEKVKET
QEDKLEGGAAKRETKEVQTNELKAEKASQKVTKKTKTVQCKVTLLDGTEYSCDLEKHAKG
QVLFDKVCEHLNLLEKDYFGLLFQESPEQKNWLDPAKEIKRQLRNLPWLFTFNVKFYPPD
PSQLTEDITRYFLCLQLRQDIASGRLPCSFVTHALLGSYTLQAELGDYDPEEHGSIDLSE
FQFAPTQTKELEEKVAELHKTHRGLSPAQADSQFLENAKRLSMYGVDLHHAKDSEGVDIK
LGVCANGLLIYKDRLRINRFAWPKILKISYKRSNFYIKVRPAELEQFESTIGFKLPNHRA
AKRLWKVCVEHHTFYRLVSPEQPPKAKFLTLGSKFRYSGRTQAQTRQASTLIDRPAPHFE
RTSSKRVSRSLDGAPIGVMDQSLMKDFPGAAGEISAYGPGLVSIAVVQDGDGRREVRSPT
KAPHLQLIEGKKNSLRVEGDNIYVRHSNLMLEELDKAQEDILKHQASISELKRNFMESTP
EPRPNEWEKRRITPLSLQTQGSSHETLNIVEEKKRAEVGKDERVITEEMNGKEISPGSGP
GEIRKVEPVTQKDSTSLSSESSSSSSESEEEDVGEYRPHHRVTEGTIREEQEYEEEVEEE
PRPAAKVVEREEAVPEASPVTQAGASVITVETVIQENVGAQKIPGEKSVHEGALKQDMGE
EAEEEPQKVNGEVSHVDIDVLPQIICCSEPPVVKTEMVTISDASQRTEISTKEVPIVQTE
TKTITYESPQIDGGAGGDSGTLLTAQTITSESVSTTTTTHITKTVKGGISETRIEKRIVI
TGDGDIDHDQALAQAIREAREQHPDMSVTRVVVHKETELAEEGED

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9PHY5	0.396	0.422	0.000	935	0.930	1.000	E9PHY5.pdb.gz	E9PHY5_HUMAN Erythrocyte membrane protein band 4.1 like 2 OS=Homo sapiens OX=9606 GN=EPB41L2 PE=1 SV=1
2	AFDB:O43491	1.000	1.000	0.000	1005	1.000	1.000	O43491.pdb.gz	E41L2_HUMAN Band 4.1-like protein 2 OS=Homo sapiens OX=9606 GN=EPB41L2 PE=1 SV=1
3	AFDB:E9PK52	0.388	0.471	4.529E-102	811	0.801	0.993	E9PK52.pdb.gz	E9PK52_HUMAN Erythrocyte membrane protein band 4.1 like 2 OS=Homo sapiens OX=9606 GN=EPB41L2 PE=1 SV=1
4	AFDB:E9PII3	0.398	0.551	1.022E-92	706	0.702	1.000	E9PII3.pdb.gz	E9PII3_HUMAN Erythrocyte membrane protein band 4.1 like 2 OS=Homo sapiens OX=9606 GN=EPB41L2 PE=1 SV=1
5	AFDB:A0A0G2KAK2	0.354	0.548	1.254E-61	638	0.389	0.613	A0A0G2KAK2.pdb.gz	A0A0G2KAK2_RAT Protein 4.1 OS=Rattus norvegicus OX=10116 GN=Epb41 PE=1 SV=2
6	AFDB:Q9H329	0.320	0.356	1.085E-35	900	0.222	0.248	Q9H329.pdb.gz	E41LB_HUMAN Band 4.1-like protein 4B OS=Homo sapiens OX=9606 GN=EPB41L4B PE=2 SV=2
7	AFDB:A0T1Z4	0.304	0.328	1.483E-35	932	0.212	0.229	A0T1Z4.pdb.gz	A0T1Z4_DROME Moesin/ezrin/radixin homolog 1 OS=Drosophila melanogaster OX=7227 GN=yrt PE=2 SV=1
8	AFDB:A0A0A0MSA4	0.150	0.145	1.645E-35	1046	0.358	0.344	A0A0A0MSA4.pdb.gz	A0A0A0MSA4_HUMAN Erythrocyte membrane protein band 4.1 like 3 OS=Homo sapiens OX=9606 GN=EPB41L3 PE=1 SV=1
9	AFDB:O94887	0.314	0.299	3.236E-35	1054	0.163	0.156	O94887.pdb.gz	FARP2_HUMAN FERM, ARHGEF and pleckstrin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=FARP2 PE=1 SV=3
10	AFDB:Q91VS8	0.313	0.296	1.251E-34	1065	0.170	0.161	Q91VS8.pdb.gz	FARP2_MOUSE FERM, ARHGEF and pleckstrin domain-containing protein 2 OS=Mus musculus OX=10090 GN=Farp2 PE=1 SV=2
11	PDB:4rm8A	0.264	0.695	1.299E-21	368	0.097	0.264	4rm8A.pdb.gz
12	PDB:7c3mA	0.221	0.373	7.862E-8	577	0.049	0.085	7c3mA.pdb.gz
13	PDB:6r9tA	0.143	0.071	3.554E-7	2185	0.034	0.016	6r9tA.pdb.gz
14	PDB:6mdhA	0.071	0.450	7.070E-4	149	0.016	0.107	6mdhA.pdb.gz
15	PDB:7lq1A	0.077	0.081	1.129E-3	950	0.038	0.040	7lq1A.pdb.gz	Discovery of a new series of PI3K-delta inhibitors from Virtual Screening.
16	PDB:3dbhI	0.078	0.772	1.253E-3	86	0.012	0.140	3dbhI.pdb.gz	Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
17	PDB:6yvaC	0.076	0.454	4.367E-3	155	0.010	0.065	6yvaC.pdb.gz
18	PDB:3tixA	0.090	0.460	5.377E-3	153	0.023	0.150	3tixA.pdb.gz
19	PDB:7rbsB	0.075	0.452	5.664E-3	157	0.010	0.064	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.
20	PDB:4pyuA	0.071	0.793	5.967E-3	76	0.003	0.039	4pyuA.pdb.gz	The conserved ubiquitin-like protein Hub1 plays a critical role in splicing in human cells.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MRA8	647	918	0.317	0.347	A0A0A0MRA8_HUMAN Erythrocyte membrane protein band 4.1 like 3 OS=Homo sapiens OX=9606 GN=EPB41L3 PE=1 SV=1
2	A0A0C4DH22	627	880	0.313	0.358	A0A0C4DH22_HUMAN Erythrocyte membrane protein band 4.1 like 1 OS=Homo sapiens OX=9606 GN=EPB41L1 PE=1 SV=1
3	A0A0G2K161	657	764	0.355	0.467	A0A0G2K161_RAT Protein 4.1 OS=Rattus norvegicus OX=10116 GN=Epb41 PE=1 SV=2
4	A0A0G2K1Q9	649	943	0.315	0.336	A0A0G2K1Q9_RAT Erythrocyte membrane protein band 4.1-like 3 OS=Rattus norvegicus OX=10116 GN=Epb41l3 PE=4 SV=2
5	A0A0G2KAK2	654	637	0.326	0.515	A0A0G2KAK2_RAT Protein 4.1 OS=Rattus norvegicus OX=10116 GN=Epb41 PE=1 SV=2
6	A0A1B0GTW6	629	1595	0.306	0.193	A0A1B0GTW6_HUMAN Erythrocyte membrane protein band 4.1 like 1 OS=Homo sapiens OX=9606 GN=EPB41L1 PE=1 SV=2
7	A0A2R8Y570	629	766	0.350	0.460	A0A2R8Y570_HUMAN Protein 4.1 OS=Homo sapiens OX=9606 GN=EPB41 PE=1 SV=1
8	A0A2R8Y5B3	1246	824	0.601	0.733	A0A2R8Y5B3_HUMAN Erythrocyte membrane protein band 4.1 like 2 (Fragment) OS=Homo sapiens OX=9606 GN=EPB41L2 PE=1 SV=1
9	A0A2R8Y5G2	657	782	0.361	0.464	A0A2R8Y5G2_HUMAN Protein 4.1 OS=Homo sapiens OX=9606 GN=EPB41 PE=1 SV=1
10	A0A2R8Y5Z6	657	787	0.361	0.461	A0A2R8Y5Z6_HUMAN Protein 4.1 OS=Homo sapiens OX=9606 GN=EPB41 PE=1 SV=1
11	A0A2R8Y6G5	634	680	0.345	0.510	A0A2R8Y6G5_HUMAN Protein 4.1 OS=Homo sapiens OX=9606 GN=EPB41 PE=1 SV=1
12	A0A2R8Y7Y3	619	601	0.314	0.526	A0A2R8Y7Y3_HUMAN Protein 4.1 OS=Homo sapiens OX=9606 GN=EPB41 PE=1 SV=1
13	A0A2R8YCW8	620	748	0.308	0.414	A0A2R8YCW8_HUMAN Erythrocyte membrane protein band 4.1 OS=Homo sapiens OX=9606 GN=EPB41 PE=1 SV=1
14	A0A2R8YD30	571	655	0.253	0.388	A0A2R8YD30_HUMAN Protein 4.1 OS=Homo sapiens OX=9606 GN=EPB41 PE=1 SV=1
15	A0A2R8YFR9	634	675	0.345	0.514	A0A2R8YFR9_HUMAN Protein 4.1 (Fragment) OS=Homo sapiens OX=9606 GN=EPB41 PE=1 SV=1
16	A0A2U3TZH6	637	841	0.348	0.416	A0A2U3TZH6_HUMAN Protein 4.1 OS=Homo sapiens OX=9606 GN=EPB41 PE=1 SV=1
17	A0A3B3IU06	629	807	0.350	0.436	A0A3B3IU06_HUMAN Protein 4.1 OS=Homo sapiens OX=9606 GN=EPB41 PE=1 SV=1
18	A0A3B3IUD6	550	607	0.277	0.458	A0A3B3IUD6_HUMAN Erythrocyte membrane protein band 4.1 OS=Homo sapiens OX=9606 GN=EPB41 PE=1 SV=1
19	A0A8I5Y1G9	678	933	0.326	0.352	A0A8I5Y1G9_RAT Erythrocyte membrane protein band 4.1-like 3 OS=Rattus norvegicus OX=10116 GN=Epb41l3 PE=1 SV=1
20	A0A8I5Y1T6	803	975	0.497	0.512	A0A8I5Y1T6_RAT Protein 4.1 OS=Rattus norvegicus OX=10116 GN=Epb41 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05902 4_1_CTD	2.5e-49	177.1	4.1 protein C-terminal domain (CTD)
2	PF08736 FA	2.4e-15	67.6	FERM adjacent (FA)
3	PF09380 FERM_C	1.6e-20	84.6	FERM C-terminal PH-like domain
4	PF00373 FERM_M	5.7e-16	70.3	FERM central domain
5	PF09379 FERM_N	7.8e-22	88.2	FERM N-terminal domain
6	PF04382 SAB	1.9e-17	74.5	SAB domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000338481

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000222644	0.925	MAGUK p55 subfamily member 6
2	9606.ENSP00000361824	0.878	Spectrin alpha chain, non-erythrocytic 1
3	9606.ENSP00000428994	0.836	Glutamate receptor 1
4	9606.ENSP00000263373	0.835	Spectrin beta chain, non-erythrocytic 4
5	9606.ENSP00000349259	0.833	Spectrin beta chain, non-erythrocytic 1
6	9606.ENSP00000367408	0.808	Peripheral plasma membrane protein CASK
7	9606.ENSP00000329797	0.804	Cell adhesion molecule 1
8	9606.ENSP00000378046	0.797	Peptidyl-prolyl cis-trans isomerase FKBP2
9	9606.ENSP00000358165	0.783	High affinity immunoglobulin gamma Fc receptor I
10	9606.ENSP00000432568	0.771	Spectrin beta chain, non-erythrocytic 2
11	9606.ENSP00000357129	0.770	Spectrin alpha chain, erythrocytic 1
12	9606.ENSP00000317790	0.768	Spectrin beta, non-erythrocytic 5
13	9606.ENSP00000451752	0.753	Spectrin beta chain, erythrocytic
14	9606.ENSP00000377298	0.743	Nuclear mitotic apparatus protein 1
15	9606.ENSP00000222374	0.715	Cell adhesion molecule 4
16	9606.ENSP00000364945	0.691	N(G),N(G)-dimethylarginine dimethylaminohydrolase 2
17	9606.ENSP00000265459	0.676	Neurexin-2
18	9606.ENSP00000385142	0.676	Neurexin-1
19	9606.ENSP00000451648	0.676	Neurexin-3
20	9606.ENSP00000280200	0.661	CD226 antigen

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008092	0.736	cytoskeletal protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.989	biological regulation
GO:0050789	0.983	regulation of biological process
GO:0050794	0.965	regulation of cellular process
GO:0009987	0.907	cellular process
GO:0048518	0.738	positive regulation of biological process
GO:0048522	0.694	positive regulation of cellular process
GO:1904375	0.678	regulation of protein localization to cell periphery
GO:1903829	0.667	positive regulation of protein localization
GO:1904377	0.636	positive regulation of protein localization to cell periphery
GO:0016043	0.592	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005654	1.000	nucleoplasm
GO:0030054	0.999	cell junction
GO:0005737	0.956	cytoplasm
GO:0005829	0.771	cytosol
GO:0043232	0.369	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]