StarFunc result for job id O43497

User Input

>input (2377 residues)
MDEEEDGAGAEESGQPRSFMRLNDLSGAGGRPGPGSAEKDPGSADSEAEGLPYPALAPVV
FFYLSQDSRPRSWCLRTVCNPWFERISMLVILLNCVTLGMFRPCEDIACDSQRCRILQAF
DDFIFAFFAVEMVVKMVALGIFGKKCYLGDTWNRLDFFIVIAGMLEYSLDLQNVSFSAVR
TVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNR
CFLPENFSLPLSVDLERYYQTENEDESPFICSQPRENGMRSCRSVPTLRGDGGGGPPCGL
DYEAYNSSSNTTCVNWNQYYTNCSAGEHNPFKGAINFDNIGYAWIAIFQVITLEGWVDIM
YFVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQRESQLMREQRVRFLSNA
STLASFSEPGSCYEELLKYLVYILRKAARRLAQVSRAAGVRVGLLSSPAPLGGQETQPSS
SCSRSHRRLSVHHLVHHHHHHHHHYHLGNGTLRAPRASPEIQDRDANGSRRLMLPPPSTP
ALSGAPPGGAESVHSFYHADCHLEPVRCQAPPPRSPSEASGRTVGSGKVYPTVHTSPPPE
TLKEKALVEVAASSGPPTLTSLNIPPGPYSSMHKLLETQSTGACQSSCKISSPCLKADSG
ACGPDSCPYCARAGAGEVELADREMPDSDSEAVYEFTQDAQHSDLRDPHSRRQRSLGPDA
EPSSVLAFWRLICDTFRKIVDSKYFGRGIMIAILVNTLSMGIEYHEQPEELTNALEISNI
VFTSLFALEMLLKLLVYGPFGYIKNPYNIFDGVIVVISVWEIVGQQGGGLSVLRTFRLMR
VLKLVRFLPALQRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHLFGCKFASERDGDTL
PDRKNFDSLLWAIVTVFQILTQEDWNKVLYNGMASTSSWAALYFIALMTFGNYVLFNLLV
AILVEGFQAEEISKREDASGQLSCIQLPVDSQGGDANKSESEPDFFSPSLDGDGDRKKCL
ALVSLGEHPELRKSLLPPLIIHTAATPMSLPKSTSTGLGEALGPASRRTSSSGSAEPGAA
HEMKSPPSARSSPHSPWSAASSWTSRRSSRNSLGRAPSLKRRSPSGERRSLLSGEGQESQ
DEEESSEEERASPAGSDHRHRGSLEREAKSSFDLPDTLQVPGLHRTASGRGSASEHQDCN
GKSASGRLARALRPDDPPLDGDDADDEGNLSKGERVRAWIRARLPACCLERDSWSAYIFP
PQSRFRLLCHRIITHKMFDHVVLVIIFLNCITIAMERPKIDPHSAERIFLTLSNYIFTAV
FLAEMTVKVVALGWCFGEQAYLRSSWNVLDGLLVLISVIDILVSMVSDSGTKILGMLRVL
RLLRTLRPLRVISRAQGLKLVVETLMSSLKPIGNIVVICCAFFIIFGILGVQLFKGKFFV
CQGEDTRNITNKSDCAEASYRWVRHKYNFDNLGQALMSLFVLASKDGWVDIMYDGLDAVG
VDQQPIMNHNPWMLLYFISFLLIVAFFVLNMFVGVVVENFHKCRQHQEEEEARRREEKRL
RRLEKKRRNLMLDDVIASGSSASAASEAQCKPYYSDYSRFRLLVHHLCTSHYLDLFITGV
IGLNVVTMAMEHYQQPQILDEALKICNYIFTVIFVLESVFKLVAFGFRRFFQDRWNQLDL
AIVLLSIMGITLEEIEVNASLPINPTIIRIMRVLRIARVLKLLKMAVGMRALLDTVMQAL
PQVGNLGLLFMLLFFIFAALGVELFGDLECDETHPCEGLGRHATFRNFGMAFLTLFRVST
GDNWNGIMKDTLRDCDQESTCYNTVISPIYFVSFVLTAQFVLVNVVIAVLMKHLEESNKE
AKEEAELEAELELEMKTLSPQPHSPLGSPFLWPGVEGPDSPDSPKPGALHPAAHARSASH
FSLEHPTDRQLFDTISLLIQGSLEWELKLMDELAGPGGQPSAFPSAPSLGGSDPQIPLAE
MEALSLTSEIVSEPSCSLALTDDSLPDDMHTLLLSALESNMQPHPTELPGPDLLTVRKSG
VSRTHSLPNDSYMCRHGSTAEGPLGHRGWGLPKAQSGSVLSVHSQPADTSYILQLPKDAP
HLLQPHSAPTWGTIPKLPPPGRSPLAQRPLRRQAAIRTDSLDVQGLGSREDLLAEVSGPS
PPLARAYSFWGQSSTQAQQHSRSHSKISKHMTPPAPCPGPEPNWGKGPPETRSSLELDTE
LSWISGDLLPPGGQEEPPSPRDLKKCYSVEAQSCQRRPTSWLDEQRRHSIAVSCLDSGSQ
PHLGTDPSNLGGQPLGGPGSRPKKKLSPPSITIDPPESQGPRTPPSPGICLRRRAPSSDS
KDPLASGPPDSMAASPSPKKDVLSLSGLSSDPADLDP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O54898	0.615	0.646	0.000	2254	0.884	0.932	O54898.pdb.gz	CAC1G_RAT Voltage-dependent T-type calcium channel subunit alpha-1G OS=Rattus norvegicus OX=10116 GN=Cacna1g PE=1 SV=2
2	AFDB:O88427	0.586	0.589	0.000	2365	0.547	0.550	O88427.pdb.gz	CAC1H_MOUSE Voltage-dependent T-type calcium channel subunit alpha-1H OS=Mus musculus OX=10090 GN=Cacna1h PE=1 SV=3
3	AFDB:O95180	0.581	0.587	0.000	2353	0.545	0.551	O95180.pdb.gz	CAC1H_HUMAN Voltage-dependent T-type calcium channel subunit alpha-1H OS=Homo sapiens OX=9606 GN=CACNA1H PE=1 SV=4
4	AFDB:Q5SUF7	0.763	0.761	0.000	2381	0.947	0.945	Q5SUF7.pdb.gz	Q5SUF7_MOUSE Voltage-dependent T-type calcium channel subunit alpha OS=Mus musculus OX=10090 GN=Cacna1g PE=1 SV=1
5	AFDB:Q9P0X4	0.568	0.606	0.000	2223	0.508	0.543	Q9P0X4.pdb.gz	CAC1I_HUMAN Voltage-dependent T-type calcium channel subunit alpha-1I OS=Homo sapiens OX=9606 GN=CACNA1I PE=1 SV=1
6	AFDB:Q9Z0Y8	0.553	0.596	0.000	2201	0.507	0.547	Q9Z0Y8.pdb.gz	CAC1I_RAT Voltage-dependent T-type calcium channel subunit alpha-1I OS=Rattus norvegicus OX=10116 GN=Cacna1i PE=1 SV=3
7	PDB:7wliA	0.463	0.957	2.641E-102	1135	0.381	0.797	7wliA.pdb.gz	Structure, gating, and pharmacology of human Ca V 3.3 channel.
8	PDB:6kzoA	0.403	0.982	3.920E-91	967	0.405	0.996	6kzoA.pdb.gz	Cryo-EM structures of apo and antagonist-bound human Cav3.1.
9	AFDB:Q00975	0.453	0.460	7.016E-69	2339	0.239	0.243	Q00975.pdb.gz	CAC1B_HUMAN Voltage-dependent N-type calcium channel subunit alpha-1B OS=Homo sapiens OX=9606 GN=CACNA1B PE=1 SV=1
10	AFDB:A0A0R4IFN9	0.440	0.451	3.811E-68	2319	0.223	0.229	A0A0R4IFN9.pdb.gz
11	AFDB:P97445	0.441	0.442	7.061E-67	2368	0.227	0.228	P97445.pdb.gz	CAC1A_MOUSE Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Mus musculus OX=10090 GN=Cacna1a PE=1 SV=2
12	AFDB:Q13936	0.458	0.489	1.835E-65	2221	0.226	0.242	Q13936.pdb.gz	CAC1C_HUMAN Voltage-dependent L-type calcium channel subunit alpha-1C OS=Homo sapiens OX=9606 GN=CACNA1C PE=1 SV=4
13	PDB:7vfsA	0.423	0.770	1.223E-52	1266	0.163	0.306	7vfsA.pdb.gz	Closed-state inactivation and pore-blocker modulation mechanisms of human Ca V 2.2.
14	PDB:7w9lA	0.433	0.711	3.697E-50	1420	0.154	0.257	7w9lA.pdb.gz	High-resolution structures of human Na v 1.7 reveal gating modulation through alpha-pi helical transition of S6 IV.
15	PDB:7mixA	0.413	0.720	2.588E-49	1326	0.158	0.284	7mixA.pdb.gz	Structure of human Ca v 2.2 channel blocked by the painkiller ziconotide.
16	PDB:7xveA	0.426	0.770	2.239E-48	1276	0.149	0.277	7xveA.pdb.gz	Unwinding and spiral sliding of S4 and domain rotation of VSD during the electromechanical coupling in Na v 1.7.
17	PDB:7we4A	0.419	0.864	5.003E-48	1122	0.137	0.290	7we4A.pdb.gz	Structural basis for high-voltage activation and subtype-specific inhibition of human Na v 1.8.
18	PDB:7uhfA	0.407	0.769	1.009E-46	1230	0.157	0.303	7uhfA.pdb.gz	Structural basis for pore blockade of human voltage-gated calcium channel Ca v 1.3 by motion sickness drug cinnarizine.
19	PDB:6j8gA	0.421	0.855	2.453E-46	1140	0.152	0.317	6j8gA.pdb.gz	Structures of human Nav1.7 channel in complex with auxiliary subunits and animal toxins.
20	PDB:6j8eA	0.421	0.854	4.545E-45	1139	0.149	0.310	6j8eA.pdb.gz	Molecular basis for pore blockade of human Na+channel Nav1.2 by the mu-conotoxin KIIIA.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A8JUY8	767	3205	0.170	0.126	A8JUY8_DROME Ca[2+]-channel protein alpha[[1]] subunit T, isoform C OS=Drosophila melanogaster OX=7227 GN=Ca-alpha1T PE=4 SV=1
2	E0CXK2	1316	1835	0.329	0.427	E0CXK2_MOUSE Voltage-dependent T-type calcium channel subunit alpha OS=Mus musculus OX=10090 GN=Cacna1i PE=1 SV=1
3	E9PWL1	3284	2272	0.768	0.803	E9PWL1_MOUSE Voltage-dependent T-type calcium channel subunit alpha OS=Mus musculus OX=10090 GN=Cacna1g PE=1 SV=1
4	E9Q7P2	1338	2199	0.352	0.381	E9Q7P2_MOUSE Voltage-dependent T-type calcium channel subunit alpha OS=Mus musculus OX=10090 GN=Cacna1i PE=1 SV=1
5	G5EBS2	660	1837	0.158	0.205	G5EBS2_CAEEL Voltage-dependent T-type calcium channel subunit alpha OS=Caenorhabditis elegans OX=6239 GN=cca-1 PE=2 SV=1
6	M9NDQ0	767	3200	0.170	0.127	M9NDQ0_DROME Ca[2+]-channel protein alpha[[1]] subunit T, isoform E OS=Drosophila melanogaster OX=7227 GN=Ca-alpha1T PE=4 SV=1
7	M9NGR9	767	3180	0.170	0.127	M9NGR9_DROME Ca[2+]-channel protein alpha[[1]] subunit T, isoform D OS=Drosophila melanogaster OX=7227 GN=Ca-alpha1T PE=4 SV=1
8	M9PGH9	767	3218	0.170	0.126	M9PGH9_DROME Ca[2+]-channel protein alpha[[1]] subunit T, isoform F OS=Drosophila melanogaster OX=7227 GN=Ca-alpha1T PE=4 SV=1
9	O43497	4882	2377	1.000	1.000	CAC1G_HUMAN Voltage-dependent T-type calcium channel subunit alpha-1G OS=Homo sapiens OX=9606 GN=CACNA1G PE=1 SV=3
10	O54898	3272	2254	0.751	0.792	CAC1G_RAT Voltage-dependent T-type calcium channel subunit alpha-1G OS=Rattus norvegicus OX=10116 GN=Cacna1g PE=1 SV=2
11	O88427	2057	2365	0.504	0.506	CAC1H_MOUSE Voltage-dependent T-type calcium channel subunit alpha-1H OS=Mus musculus OX=10090 GN=Cacna1h PE=1 SV=3
12	O95180	2022	2353	0.507	0.513	CAC1H_HUMAN Voltage-dependent T-type calcium channel subunit alpha-1H OS=Homo sapiens OX=9606 GN=CACNA1H PE=1 SV=4
13	Q27YN9	3764	2265	0.775	0.813	Q27YN9_MOUSE T-type calcium channel alpha 1G subunit OS=Mus musculus OX=10090 GN=Cacna1g PE=2 SV=1
14	Q3UQG9	969	853	0.199	0.556	Q3UQG9_MOUSE Ion transport domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Cacna1g PE=2 SV=1
15	Q5SUF5	3719	2247	0.767	0.811	Q5SUF5_MOUSE Calcium channel, voltage-dependent, T type, alpha 1G subunit OS=Mus musculus OX=10090 GN=Cacna1g PE=1 SV=1
16	Q5SUF6	3818	2288	0.783	0.813	Q5SUF6_MOUSE Voltage-dependent T-type calcium channel subunit alpha OS=Mus musculus OX=10090 GN=Cacna1g PE=1 SV=1
17	Q5SUF7	4076	2381	0.942	0.941	Q5SUF7_MOUSE Voltage-dependent T-type calcium channel subunit alpha OS=Mus musculus OX=10090 GN=Cacna1g PE=1 SV=1
18	Q5SUF8	3271	2254	0.756	0.797	Q5SUF8_MOUSE Calcium channel, voltage-dependent, T type, alpha 1G subunit OS=Mus musculus OX=10090 GN=Cacna1g PE=1 SV=1
19	Q5SUF9	3766	2265	0.775	0.813	Q5SUF9_MOUSE Calcium channel, voltage-dependent, T type, alpha 1G subunit OS=Mus musculus OX=10090 GN=Cacna1g PE=1 SV=1
20	Q5SUG0	3324	2277	0.764	0.798	Q5SUG0_MOUSE Voltage-dependent T-type calcium channel subunit alpha OS=Mus musculus OX=10090 GN=Cacna1g PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00520 Ion_trans	5.8e-250	836.4	Ion transport protein
2	PF01741 MscL	6.6e+02	12.0	Large-conductance mechanosensitive channel, MscL
3	PF08016 PKD_channel	6.9e-16	69.9	Polycystin cation channel

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000352011

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000377840	0.905	Voltage-dependent L-type calcium channel subunit beta-1
2	9606.ENSP00000341940	0.875	Caveolin-3
3	9606.ENSP00000419313	0.867	Short transient receptor potential channel 1
4	9606.ENSP00000262839	0.853	Short transient receptor potential channel 5
5	9606.ENSP00000369027	0.843	Short transient receptor potential channel 4
6	9606.ENSP00000343925	0.836	Estrogen receptor beta
7	9606.ENSP00000418081	0.830	Voltage-dependent calcium channel subunit alpha-2/delta-2
8	9606.ENSP00000380432	0.826	Insulin
9	9606.ENSP00000385019	0.825	Voltage-dependent T-type calcium channel subunit alpha-1I
10	9606.ENSP00000320025	0.823	Voltage-dependent L-type calcium channel subunit beta-2
11	9606.ENSP00000349320	0.819	Voltage-dependent calcium channel subunit alpha-2/delta-1
12	9606.ENSP00000305260	0.818	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2
13	9606.ENSP00000334198	0.814	Voltage-dependent T-type calcium channel subunit alpha-1H
14	9606.ENSP00000477999	0.813	Nitric oxide synthase, brain
15	9606.ENSP00000438949	0.807	Voltage-dependent L-type calcium channel subunit beta-4
16	9606.ENSP00000317580	0.806	Neurogenin-1
17	9606.ENSP00000301050	0.797	Voltage-dependent L-type calcium channel subunit beta-3
18	9606.ENSP00000419081	0.791	Calmodulin-like protein 4
19	9606.ENSP00000419101	0.790	Voltage-dependent calcium channel subunit alpha-2/delta-3
20	9606.ENSP00000352608	0.772	Ryanodine receptor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008332	1.000	low voltage-gated calcium channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007268	0.997	chemical synaptic transmission
GO:0002027	0.997	regulation of heart rate
GO:0010038	0.996	response to metal ion
GO:0001508	0.996	action potential
GO:0003254	0.996	regulation of membrane depolarization
GO:0006810	0.410	transport
GO:0006811	0.396	monoatomic ion transport
GO:0055085	0.325	transmembrane transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0032991	0.856	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	1.000	Ca(2+)(in) = Ca(2+)(out)

[back to server]