StarFunc result for job id O43504

User Input

>input (91 residues)
MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPT
DIPVVCLESDNGNIMIQKHDGITVAVHKMAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43504	1.000	1.000	5.798E-20	91	1.000	1.000	O43504.pdb.gz	LTOR5_HUMAN Ragulator complex protein LAMTOR5 OS=Homo sapiens OX=9606 GN=LAMTOR5 PE=1 SV=1
2	PDB:3ms6A	0.930	0.930	2.404E-17	91	1.000	1.000	3ms6A.pdb.gz
3	AFDB:O96824	0.933	0.853	1.395E-10	100	0.330	0.300	O96824.pdb.gz	O96824_DROME Late endosomal/lysosomal adaptor and MAPK and MTOR activator 5 OS=Drosophila melanogaster OX=7227 GN=Lamtor5 PE=1 SV=1
4	AFDB:Q38D18	0.755	0.708	1.372E-6	98	0.231	0.214	Q38D18.pdb.gz	Q38D18_TRYB2 Dynein light chain roadblock OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.4920 PE=3 SV=1
5	AFDB:Q381D2	0.816	0.764	1.463E-6	98	0.209	0.194	Q381D2.pdb.gz	Q381D2_TRYB2 Dynein light chain roadblock OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.8240 PE=3 SV=1
6	AFDB:Q7KMS3	0.814	0.770	3.374E-6	97	0.231	0.216	Q7KMS3.pdb.gz	Q7KMS3_DROME Dynein light chain roadblock OS=Drosophila melanogaster OX=7227 GN=robl PE=1 SV=1
7	PDB:1y4oA	0.652	0.588	4.581E-6	104	0.154	0.135	1y4oA.pdb.gz
8	PDB:3l9kA	0.765	0.736	5.556E-6	95	0.209	0.200	3l9kA.pdb.gz
9	AFDB:Q8TF09	0.798	0.761	5.644E-6	96	0.198	0.188	Q8TF09.pdb.gz	DLRB2_HUMAN Dynein light chain roadblock-type 2 OS=Homo sapiens OX=9606 GN=DYNLRB2 PE=1 SV=1
10	AFDB:Q9VQA6	0.769	0.728	6.844E-6	97	0.165	0.155	Q9VQA6.pdb.gz	Q9VQA6_DROME Dynein light chain roadblock OS=Drosophila melanogaster OX=7227 GN=robl22E PE=1 SV=1
11	AFDB:Q9JHS3	0.764	0.579	7.783E-6	125	0.132	0.096	Q9JHS3.pdb.gz	LTOR2_MOUSE Ragulator complex protein LAMTOR2 OS=Mus musculus OX=10090 GN=Lamtor2 PE=1 SV=1
12	AFDB:Q9SWQ6	0.760	0.670	8.851E-6	105	0.176	0.152	Q9SWQ6.pdb.gz	Q9SWQ6_CHLRE Dynein light chain roadblock OS=Chlamydomonas reinhardtii OX=3055 GN=LC7 PE=1 SV=1
13	AFDB:P62627	0.788	0.752	1.007E-5	96	0.165	0.156	P62627.pdb.gz	DLRB1_MOUSE Dynein light chain roadblock-type 1 OS=Mus musculus OX=10090 GN=Dynlrb1 PE=1 SV=3
14	PDB:6b9xB	0.780	0.589	1.281E-5	126	0.132	0.095	6b9xB.pdb.gz
15	PDB:5y39D	0.780	0.725	1.657E-5	99	0.198	0.182	5y39D.pdb.gz
16	PDB:4xpmB	0.530	0.683	1.767E-5	67	0.220	0.299	4xpmB.pdb.gz
17	PDB:7kzmI	0.655	0.594	3.584E-5	103	0.176	0.155	7kzmI.pdb.gz	Structure of a microtubule-bound axonemal dynein.
18	PDB:5x6uA	0.679	0.530	1.003E-4	124	0.099	0.073	5x6uA.pdb.gz
19	PDB:3t1rC	0.764	0.535	2.991E-4	136	0.165	0.110	3t1rC.pdb.gz	Structural analysis of the Ras-like G protein MglA and its cognate GAP MglB and implications for bacterial polarity.
20	PDB:4arzA	0.573	0.225	4.399E-4	291	0.121	0.038	4arzA.pdb.gz	Crystal Structure of the Gtr1Pgtp-Gtr2Pgdp Complex Reveals Large Structural Rearrangements Triggered by GTP-to-Gdp Conversion

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43504	1.91e-62	186	91	1.000	1.000	LTOR5_HUMAN Ragulator complex protein LAMTOR5 OS=Homo sapiens OX=9606 GN=LAMTOR5 PE=1 SV=1
2	O96824	2.33e-08	49.3	100	0.330	0.300	O96824_DROME Late endosomal/lysosomal adaptor and MAPK and MTOR activator 5 OS=Drosophila melanogaster OX=7227 GN=Lamtor5 PE=1 SV=1
3	P0DTD1	4.1	28.1	7096	0.132	0.002	R1AB_SARS2 Replicase polyprotein 1ab OS=Severe acute respiratory syndrome coronavirus 2 OX=2697049 GN=rep PE=1 SV=1
4	A1E5U5	6.0	27.7	6497	0.143	0.002	A1E5U5_FLAJ1 SprB OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / NBRC 14942 / NCIMB 11054 / UW101) OX=376686 GN=sprB PE=4 SV=1
5	F1M2Z5	6.7	26.9	100	0.110	0.100	NCMAP_RAT Noncompact myelin-associated protein OS=Rattus norvegicus OX=10116 GN=Ncmap PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16672 LAMTOR5	3.2e-32	121.8	Ragulator complex protein LAMTOR5
2	PF03259 Robl_LC7	2.1e+02	13.1	Roadblock/LC7 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 118797.XP_007449352.1

Rank	PPI partner	STRING score	Description
1	118797.XP_007457974.1	0.999	Late endosomal/lysosomal adaptor, MAPK and MTOR activator 2
2	118797.XP_007463862.1	0.999	Late endosomal/lysosomal adaptor, MAPK and MTOR activator 3
3	118797.XP_007468928.1	0.999	Late endosomal/lysosomal adaptor, MAPK and MTOR activator 4
4	118797.XP_007463088.1	0.998	Late endosomal/lysosomal adaptor, MAPK and MTOR activator 1
5	118797.XP_007469332.1	0.998	Solute carrier family 38 member 9
6	118797.XP_007453790.1	0.996	Ras-related GTP-binding protein B-like isoform X1
7	118797.XP_007472203.1	0.996	Ras related GTP binding A
8	118797.XP_007453848.1	0.992	Ras related GTP binding C
9	118797.XP_007462400.1	0.989	Regulatory-associated protein of mTOR isoform X1
10	118797.XP_007466316.1	0.986	Ras-related GTP-binding protein D
11	118797.XP_007463247.1	0.967	Mechanistic target of rapamycin
12	118797.XP_007448427.1	0.901	Folliculin
13	118797.XP_007446689.1	0.886	Folliculin-interacting protein 2
14	118797.XP_007463323.1	0.853	Subunit of the peripheral V1 complex of vacuolar ATPase. Subunit C is necessary for the assembly of the catalytic sector of the enzyme and is likely to have a specific function in its catalytic activity. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.
15	118797.XP_007470640.1	0.852	ATPase H+ transporting V1 subunit B2
16	118797.XP_007469755.1	0.844	Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells
17	118797.XP_007449077.1	0.836	V-type proton ATPase subunit D isoform X1
18	118797.XP_007449792.1	0.836	ATPase H+ transporting V1 subunit G1
19	118797.XP_007469548.1	0.834	ATPase H+ transporting V1 subunit E1
20	118797.XP_007469592.1	0.832	V-type proton ATPase catalytic subunit A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0060090	1.000	molecular adaptor activity
GO:0005515	1.000	protein binding
GO:0005085	1.000	guanyl-nucleotide exchange factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0065007	0.982	biological regulation
GO:0051179	0.977	localization
GO:0071417	0.946	cellular response to organonitrogen compound
GO:1901700	0.929	response to oxygen-containing compound
GO:1902533	0.874	positive regulation of intracellular signal transduction
GO:0008104	0.823	protein localization
GO:1901701	0.481	cellular response to oxygen-containing compound
GO:0065009	0.370	regulation of molecular function
GO:0006810	0.348	transport
GO:0043281	0.306	regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0071840	0.300	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0005764	0.997	lysosome
GO:0098852	0.996	lytic vacuole membrane
GO:0032045	0.995	guanyl-nucleotide exchange factor complex
GO:0098796	0.994	membrane protein complex
GO:0005765	0.993	lysosomal membrane
GO:1902494	0.891	catalytic complex
GO:0043233	0.318	organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]