StarFunc result for job id O43508

User Input

>input (249 residues)
MAARRSQRRRGRRGEPGTALLVPLALGLGLALACLGLLLAVVSLGSRASLSAQEPAQEEL
VAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQD
GAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLD
LLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFL
TYFGLFQVH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43508	1.000	1.000	2.469E-42	249	1.000	1.000	O43508.pdb.gz	TNF12_HUMAN Tumor necrosis factor ligand superfamily member 12 OS=Homo sapiens OX=9606 GN=TNFSF12 PE=1 SV=1
2	AFDB:O54907	0.612	0.612	5.362E-37	249	0.892	0.892	O54907.pdb.gz	TNF12_MOUSE Tumor necrosis factor ligand superfamily member 12 OS=Mus musculus OX=10090 GN=Tnfsf12 PE=2 SV=2
3	AFDB:B0YIF1	0.483	0.344	1.624E-12	359	0.221	0.153	B0YIF1.pdb.gz	B0YIF1_DANRE Ectodysplasin OS=Danio rerio OX=7955 GN=si:ch73-223d24.5 PE=2 SV=1
4	AFDB:O54693	0.480	0.314	1.125E-11	391	0.225	0.143	O54693.pdb.gz	EDA_MOUSE Ectodysplasin-A OS=Mus musculus OX=10090 GN=Eda PE=1 SV=2
5	AFDB:A0A0U5J7Q1	0.494	0.436	9.107E-11	285	0.201	0.175	A0A0U5J7Q1.pdb.gz	A0A0U5J7Q1_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 GN=TNLG7A PE=2 SV=1
6	AFDB:Q8MUJ1	0.416	0.260	9.107E-11	415	0.165	0.099	Q8MUJ1.pdb.gz	EIGER_DROME Protein eiger OS=Drosophila melanogaster OX=7227 GN=egr PE=1 SV=1
7	AFDB:A8WG11	0.469	0.439	1.894E-10	268	0.169	0.157	A8WG11.pdb.gz	A8WG11_DANRE TNF superfamily member 13b-like protein OS=Danio rerio OX=7955 GN=tnfsf13b PE=2 SV=1
8	AFDB:O75888	0.474	0.472	8.188E-10	250	0.197	0.196	O75888.pdb.gz	TNF13_HUMAN Tumor necrosis factor ligand superfamily member 13 OS=Homo sapiens OX=9606 GN=TNFSF13 PE=1 SV=1
9	AFDB:B0LKN7	0.476	0.428	1.244E-9	280	0.181	0.161	B0LKN7.pdb.gz	B0LKN7_BOVIN B-cell activating factor OS=Bos taurus OX=9913 GN=TNFSF13B PE=2 SV=1
10	AFDB:D2DMJ8	0.508	0.621	3.189E-9	199	0.153	0.191	D2DMJ8.pdb.gz	D2DMJ8_DANRE A proliferation-inducing ligand-like protein OS=Danio rerio OX=7955 GN=april PE=2 SV=1
11	PDB:5kc6B	0.412	0.672	1.012E-5	144	0.064	0.111	5kc6B.pdb.gz
12	PDB:5h4bA	0.399	0.684	2.103E-5	136	0.068	0.125	5h4bA.pdb.gz
13	PDB:7e57B	0.358	0.669	4.856E-5	123	0.064	0.130	7e57B.pdb.gz	Atypical TNF-TNFR superfamily binding interface in the GITR-GITRL complex for T cell activation.
14	PDB:5eiyB	0.099	0.049	2.092E-2	658	0.056	0.021	5eiyB.pdb.gz	Observing cellulose biosynthesis and membrane translocation in crystallo.
15	PDB:7l2zF	0.232	0.100	2.323E-2	664	0.044	0.017	7l2zF.pdb.gz
16	PDB:5jovA	0.171	0.058	2.864E-2	949	0.076	0.020	5jovA.pdb.gz	Structural dissection of a complex Bacteroides ovatus gene locus conferring xyloglucan metabolism in the human gut.
17	PDB:6ds5A	0.208	0.281	5.090E-2	160	0.064	0.100	6ds5A.pdb.gz
18	PDB:5a3oA	0.236	0.454	8.587E-2	114	0.032	0.070	5a3oA.pdb.gz	Cinnamide Derivatives of D-Mannose as Inhibitors of the Bacterial Virulence Factor Lecb from Pseudomonas Aeruginosa
19	PDB:2waaA	0.183	0.149	1.115E-1	335	0.052	0.039	2waaA.pdb.gz
20	PDB:3fxiC	0.176	0.260	1.449E-1	140	0.072	0.129	3fxiC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43508	0.0	497	249	1.000	1.000	TNF12_HUMAN Tumor necrosis factor ligand superfamily member 12 OS=Homo sapiens OX=9606 GN=TNFSF12 PE=1 SV=1
2	Q4ACW9	0.0	497	249	1.000	1.000	Q4ACW9_HUMAN HCG1991317, isoform CRA_b OS=Homo sapiens OX=9606 GN=TWEAK PE=1 SV=1
3	O54907	7.15e-135	381	249	0.892	0.892	TNF12_MOUSE Tumor necrosis factor ligand superfamily member 12 OS=Mus musculus OX=10090 GN=Tnfsf12 PE=2 SV=2
4	Q8MUJ1	8.41e-04	42.4	415	0.165	0.099	EIGER_DROME Protein eiger OS=Drosophila melanogaster OX=7227 GN=egr PE=1 SV=1
5	P50592	0.48	33.9	291	0.124	0.107	TNF10_MOUSE Tumor necrosis factor ligand superfamily member 10 OS=Mus musculus OX=10090 GN=Tnfsf10 PE=2 SV=1
6	P50591	1.4	32.3	281	0.104	0.093	TNF10_HUMAN Tumor necrosis factor ligand superfamily member 10 OS=Homo sapiens OX=9606 GN=TNFSF10 PE=1 SV=1
7	O14788	1.5	32.3	317	0.116	0.091	TNF11_HUMAN Tumor necrosis factor ligand superfamily member 11 OS=Homo sapiens OX=9606 GN=TNFSF11 PE=1 SV=1
8	M9PHD8	1.7	32.3	1714	0.068	0.010	M9PHD8_DROME TATA box-binding protein-like 1 OS=Drosophila melanogaster OX=7227 GN=Trf2 PE=3 SV=1
9	Q07DP5	1.7	32.3	1715	0.068	0.010	Q07DP5_DROME TATA box-binding protein-like 1 OS=Drosophila melanogaster OX=7227 GN=Trf2 PE=2 SV=1
10	Q9BY19	2.2	31.6	250	0.068	0.068	M4A8_HUMAN Membrane-spanning 4-domains subfamily A member 8 OS=Homo sapiens OX=9606 GN=MS4A8 PE=2 SV=1
11	G5EC05	2.4	32.0	1570	0.080	0.013	G5EC05_CAEEL Cnd1 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=evl-14 PE=1 SV=1
12	P41273	3.1	31.2	254	0.052	0.051	TNFL9_HUMAN Tumor necrosis factor ligand superfamily member 9 OS=Homo sapiens OX=9606 GN=TNFSF9 PE=1 SV=1
13	A8DYK5	3.8	31.6	1306	0.084	0.016	A8DYK5_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Isha PE=1 SV=1
14	A0A0U5J7B5	4.1	30.8	292	0.060	0.051	A0A0U5J7B5_RAT Tumor necrosis factor ligand superfamily member OS=Rattus norvegicus OX=10116 GN=Tnfsf10 PE=2 SV=1
15	A0A8I5ZY27	4.2	30.8	289	0.116	0.100	A0A8I5ZY27_RAT Tumor necrosis factor ligand superfamily member OS=Rattus norvegicus OX=10116 GN=Tnfsf10 PE=3 SV=1
16	Q02105	4.3	30.8	246	0.084	0.085	C1QC_MOUSE Complement C1q subcomponent subunit C OS=Mus musculus OX=10090 GN=C1qc PE=1 SV=2
17	Q9L7Q2	4.7	31.2	1906	0.068	0.009	ZMPB_STRPN Zinc metalloprotease ZmpB OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=zmpB PE=3 SV=2
18	Q385R2	9.0	30.0	1041	0.068	0.016	Q385R2_TRYB2 Methyltransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2710 PE=1 SV=1
19	P32971	9.1	29.6	234	0.064	0.068	TNFL8_HUMAN Tumor necrosis factor ligand superfamily member 8 OS=Homo sapiens OX=9606 GN=TNFSF8 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00386 C1q	20	16.8	C1q domain
2	PF00229 TNF	3.8e-13	60.9	TNF(Tumour Necrosis Factor) family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000293825

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000326737	0.999	Tumor necrosis factor receptor superfamily member 12A
2	9606.ENSP00000367013	0.998	Tumor necrosis factor receptor superfamily member 25
3	9606.ENSP00000352071	0.976	Scavenger receptor cysteine-rich type 1 protein M130
4	9606.ENSP00000247668	0.952	TNF receptor-associated factor 2
5	9606.ENSP00000351273	0.944	Caspase-8
6	9606.ENSP00000341268	0.941	Tumor necrosis factor receptor type 1-associated DEATH domain protein
7	9606.ENSP00000301838	0.939	FAS-associated death domain protein
8	9606.ENSP00000311032	0.936	Caspase-3
9	9606.ENSP00000259808	0.934	Receptor-interacting serine/threonine-protein kinase 1
10	9606.ENSP00000482657	0.925	Mitogen-activated protein kinase kinase kinase 14
11	9606.ENSP00000286186	0.921	Caspase-10
12	9606.ENSP00000318822	0.910	BH3-interacting domain death agonist
13	9606.ENSP00000365048	0.898	Tumor necrosis factor ligand superfamily member 13B
14	9606.ENSP00000316109	0.890	Angiogenic factor with G patch and FHA domains 1
15	9606.ENSP00000398698	0.846	Tumor necrosis factor
16	9606.ENSP00000477613	0.842	Baculoviral IAP repeat-containing protein 2
17	9606.ENSP00000291232	0.798	Tumor necrosis factor receptor superfamily member 13C
18	9606.ENSP00000365435	0.770	Tumor necrosis factor receptor superfamily member 1B
19	9606.ENSP00000304915	0.764	Interleukin-13
20	9606.ENSP00000454207	0.760	TNF receptor-associated factor 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005125	1.000	cytokine activity
GO:0005126	0.450	cytokine receptor binding
GO:0042802	0.315	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0009987	0.997	cellular process
GO:0050896	0.995	response to stimulus
GO:0023052	0.995	signaling
GO:0048518	0.985	positive regulation of biological process
GO:0097190	0.985	apoptotic signaling pathway
GO:0048522	0.979	positive regulation of cellular process
GO:0048583	0.971	regulation of response to stimulus
GO:0019222	0.965	regulation of metabolic process
GO:0048584	0.963	positive regulation of response to stimulus
GO:0080090	0.925	regulation of primary metabolic process
GO:0060255	0.925	regulation of macromolecule metabolic process
GO:0051171	0.924	regulation of nitrogen compound metabolic process
GO:0023051	0.889	regulation of signaling
GO:0010646	0.889	regulation of cell communication
GO:0009966	0.879	regulation of signal transduction
GO:0010647	0.876	positive regulation of cell communication
GO:0023056	0.874	positive regulation of signaling
GO:0009967	0.864	positive regulation of signal transduction
GO:0007166	0.858	cell surface receptor signaling pathway
GO:0010941	0.826	regulation of cell death
GO:0051239	0.804	regulation of multicellular organismal process
GO:0043067	0.798	regulation of programmed cell death
GO:0010942	0.786	positive regulation of cell death
GO:0009893	0.781	positive regulation of metabolic process
GO:0010604	0.769	positive regulation of macromolecule metabolic process
GO:0043065	0.768	positive regulation of apoptotic process
GO:0051173	0.759	positive regulation of nitrogen compound metabolic process
GO:2001233	0.721	regulation of apoptotic signaling pathway
GO:0042127	0.693	regulation of cell population proliferation
GO:0051240	0.687	positive regulation of multicellular organismal process
GO:0051246	0.658	regulation of protein metabolic process
GO:0032501	0.637	multicellular organismal process
GO:0051094	0.615	positive regulation of developmental process
GO:2000026	0.610	regulation of multicellular organismal development
GO:0051247	0.603	positive regulation of protein metabolic process
GO:2001236	0.515	regulation of extrinsic apoptotic signaling pathway
GO:0097191	0.490	extrinsic apoptotic signaling pathway
GO:0008284	0.474	positive regulation of cell population proliferation
GO:2001235	0.458	positive regulation of apoptotic signaling pathway
GO:2001238	0.388	positive regulation of extrinsic apoptotic signaling pathway
GO:0031323	0.382	regulation of cellular metabolic process
GO:0045765	0.380	regulation of angiogenesis
GO:1902531	0.345	regulation of intracellular signal transduction
GO:0009894	0.339	regulation of catabolic process
GO:0010468	0.327	regulation of gene expression
GO:0016477	0.308	cell migration

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0016020	0.968	membrane
GO:0071944	0.958	cell periphery
GO:0005886	0.954	plasma membrane
GO:0005622	0.938	intracellular anatomical structure
GO:0005737	0.926	cytoplasm
GO:0043231	0.794	intracellular membrane-bounded organelle
GO:0005615	0.673	extracellular space
GO:0005829	0.552	cytosol
GO:0048471	0.319	perinuclear region of cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]