StarFunc result for job id O43513

User Input

>input (233 residues)
MGEPQQVSALPPPPMQYIKEYTDENIQEGLAPKPPPPIKDSYMMFGNQFQCDDLIIRPLE
SQGIERLHPMQFDHKKELRKLNMSILINFLDLLDILIRSPGSIKREEKLEDLKLLFVHVH
HLINEYRPHQARETLRVMMEVQKRQRLETAERFQKHLERVIEMIQNCLASLPDDLPHSEA
GMRVKTEPMDADDSNNCTGQNEHQRENSGHRRDQIIEKDAALCVLIDEMNERP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D4A7V2	0.979	0.979	4.986E-37	233	0.979	0.979	D4A7V2.pdb.gz	D4A7V2_RAT Mediator of RNA polymerase II transcription subunit 7 OS=Rattus norvegicus OX=10116 GN=Med7 PE=1 SV=1
2	AFDB:Q9GYV9	0.553	0.582	2.968E-21	220	0.502	0.532	Q9GYV9.pdb.gz	MED7_DROME Mediator of RNA polymerase II transcription subunit 7 OS=Drosophila melanogaster OX=7227 GN=MED7 PE=1 SV=1
3	PDB:7enag	0.555	0.742	9.174E-21	166	0.708	0.994	7enag.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
4	AFDB:Q95Q17	0.651	0.609	1.512E-13	251	0.313	0.291	Q95Q17.pdb.gz	MED7_CAEEL Mediator of RNA polymerase II transcription subunit 7 OS=Caenorhabditis elegans OX=6239 GN=let-49 PE=1 SV=1
5	AFDB:Q9LYW3	0.620	0.838	3.039E-12	168	0.240	0.333	Q9LYW3.pdb.gz	MED7A_ARATH Mediator of RNA polymerase II transcription subunit 7a OS=Arabidopsis thaliana OX=3702 GN=MED7A PE=1 SV=1
6	AFDB:Q08278	0.514	0.536	6.078E-10	222	0.283	0.297	Q08278.pdb.gz	MED7_YEAST Mediator of RNA polymerase II transcription subunit 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MED7 PE=1 SV=1
7	AFDB:O60104	0.520	0.339	4.070E-6	376	0.296	0.184	O60104.pdb.gz	MED7_SCHPO Mediator of RNA polymerase II transcription subunit 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=med7 PE=1 SV=1
8	PDB:5n9jE	0.516	0.585	4.828E-6	201	0.232	0.269	5n9jE.pdb.gz
9	PDB:5oqmi	0.319	0.510	1.517E-4	136	0.176	0.301	5oqmi.pdb.gz	Structures of transcription pre-initiation complex with TFIIH and Mediator.
10	AFDB:B5X503	0.136	0.060	9.167E-2	615	0.155	0.059	B5X503.pdb.gz	B5X503_ARATH At5g11240 OS=Arabidopsis thaliana OX=3702 GN=NUGWD1 PE=1 SV=1
11	PDB:1ykhB	0.216	0.429	1.159E-1	114	0.082	0.167	1ykhB.pdb.gz
12	AFDB:Q59WV0	0.247	0.170	1.261E-1	346	0.137	0.092	Q59WV0.pdb.gz	PALI_CANAL pH-response regulator protein palI/RIM9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RIM9 PE=3 SV=3
13	AFDB:A3KDM3	0.184	0.056	1.628E-1	1160	0.133	0.027	A3KDM3.pdb.gz	A3KDM3_DANRE CTR9 homolog, Paf1/RNA polymerase II complex component OS=Danio rerio OX=7955 GN=fc54a06 PE=1 SV=1
14	AFDB:Q57UN8	0.189	0.060	1.736E-1	1126	0.077	0.016	Q57UN8.pdb.gz	Q57UN8_TRYB2 DNA excision repair protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.5F10.540 PE=4 SV=1
15	PDB:5oqmk	0.193	0.341	2.195E-1	127	0.060	0.110	5oqmk.pdb.gz	Structures of transcription pre-initiation complex with TFIIH and Mediator.
16	PDB:3j6bT	0.220	0.240	2.494E-1	209	0.103	0.115	3j6bT.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.
17	PDB:7ungi	0.203	0.190	2.658E-1	250	0.086	0.080	7ungi.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
18	PDB:7v2wJ	0.193	0.191	3.020E-1	236	0.142	0.140	7v2wJ.pdb.gz
19	PDB:7enal	0.223	0.405	3.431E-1	126	0.064	0.119	7enal.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
20	PDB:4n78F	0.213	0.271	3.657E-1	156	0.099	0.147	4n78F.pdb.gz	The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43513	4.52e-173	476	233	1.000	1.000	MED7_HUMAN Mediator of RNA polymerase II transcription subunit 7 OS=Homo sapiens OX=9606 GN=MED7 PE=1 SV=1
2	Q6IAZ5	4.52e-173	476	233	1.000	1.000	Q6IAZ5_HUMAN Mediator of RNA polymerase II transcription subunit 7 OS=Homo sapiens OX=9606 GN=CRSP9 PE=1 SV=1
3	D4A7V2	1.37e-169	468	233	0.979	0.979	D4A7V2_RAT Mediator of RNA polymerase II transcription subunit 7 OS=Rattus norvegicus OX=10116 GN=Med7 PE=1 SV=1
4	Q9CZB6	1.70e-167	462	233	0.970	0.970	MED7_MOUSE Mediator of RNA polymerase II transcription subunit 7 OS=Mus musculus OX=10090 GN=Med7 PE=1 SV=2
5	E5RIE8	2.25e-142	397	195	0.837	1.000	E5RIE8_HUMAN Mediator of RNA polymerase II transcription subunit 7 (Fragment) OS=Homo sapiens OX=9606 GN=MED7 PE=1 SV=1
6	Q9GYV9	8.74e-65	202	220	0.498	0.527	MED7_DROME Mediator of RNA polymerase II transcription subunit 7 OS=Drosophila melanogaster OX=7227 GN=MED7 PE=1 SV=1
7	Q95Q17	9.74e-35	126	251	0.275	0.255	MED7_CAEEL Mediator of RNA polymerase II transcription subunit 7 OS=Caenorhabditis elegans OX=6239 GN=let-49 PE=1 SV=1
8	Q9LZD7	3.80e-26	101	168	0.227	0.315	MED7B_ARATH Mediator of RNA polymerase II transcription subunit 7b OS=Arabidopsis thaliana OX=3702 GN=MED7B PE=1 SV=1
9	Q9LYW3	8.98e-19	82.4	168	0.189	0.262	MED7A_ARATH Mediator of RNA polymerase II transcription subunit 7a OS=Arabidopsis thaliana OX=3702 GN=MED7A PE=1 SV=1
10	Q08278	2.32e-11	63.5	222	0.227	0.239	MED7_YEAST Mediator of RNA polymerase II transcription subunit 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MED7 PE=1 SV=1
11	O60104	1.10e-06	50.8	376	0.176	0.109	MED7_SCHPO Mediator of RNA polymerase II transcription subunit 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=med7 PE=1 SV=1
12	O70496	1.1	32.7	803	0.082	0.024	CLCN7_MOUSE H(+)/Cl(-) exchange transporter 7 OS=Mus musculus OX=10090 GN=Clcn7 PE=1 SV=1
13	P51799	1.1	32.7	803	0.082	0.024	CLCN7_RAT H(+)/Cl(-) exchange transporter 7 OS=Rattus norvegicus OX=10116 GN=Clcn7 PE=2 SV=1
14	P51798	1.7	32.3	805	0.082	0.024	CLCN7_HUMAN H(+)/Cl(-) exchange transporter 7 OS=Homo sapiens OX=9606 GN=CLCN7 PE=1 SV=2
15	F4IDJ0	4.0	31.2	830	0.077	0.022	NOC3_ARATH Nucleolar complex-associated protein 3 OS=Arabidopsis thaliana OX=3702 GN=NOC3 PE=1 SV=1
16	A0A0B4KF82	4.3	31.2	1818	0.090	0.012	A0A0B4KF82_DROME Canoe, isoform I OS=Drosophila melanogaster OX=7227 GN=cno PE=1 SV=1
17	Q8IPP3	4.6	30.8	1817	0.090	0.012	Q8IPP3_DROME Canoe, isoform D OS=Drosophila melanogaster OX=7227 GN=cno PE=1 SV=2
18	Q5ZR40	5.6	30.8	2006	0.073	0.008	Q5ZR40_CAEEL BPTI/Kunitz inhibitor domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=mec-1 PE=1 SV=2
19	A0A1D8PCV7	5.7	30.8	1404	0.142	0.024	A0A1D8PCV7_CANAL Alpha-aminoadipate reductase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=LYS2 PE=3 SV=1
20	Q5ZR35	5.7	30.8	1604	0.073	0.011	Q5ZR35_CAEEL BPTI/Kunitz inhibitor domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=mec-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09850 DotU	5.9	18.0	Type VI secretion system protein DotU
2	PF05983 Med7	8.5e-41	151.7	MED7 protein
3	PF09805 Nop25	3.5e+02	13.1	Nucleolar protein 12 (25kDa)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000004752

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000011261	0.997	Mediator of RNA polymerase II transcription subunit 31
2	61853.ENSNLEP00000013783	0.997	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
3	61853.ENSNLEP00000002236	0.996	Mediator complex subunit 6
4	61853.ENSNLEP00000006572	0.996	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
5	61853.ENSNLEP00000002188	0.995	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
6	61853.ENSNLEP00000017049	0.993	Cyclin-dependent kinase 8
7	61853.ENSNLEP00000020163	0.993	Mediator complex subunit 28
8	61853.ENSNLEP00000003648	0.992	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
9	61853.ENSNLEP00000016487	0.992	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
10	61853.ENSNLEP00000016790	0.992	Cyclin C
11	61853.ENSNLEP00000006731	0.989	Uncharacterized protein
12	61853.ENSNLEP00000005897	0.987	Mediator complex subunit 30
13	61853.ENSNLEP00000015585	0.987	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
14	61853.ENSNLEP00000016423	0.987	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
15	61853.ENSNLEP00000017574	0.987	Mediator complex subunit 23
16	61853.ENSNLEP00000023696	0.986	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
17	61853.ENSNLEP00000000991	0.985	Mediator of RNA polymerase II transcription subunit 1
18	61853.ENSNLEP00000017539	0.985	Mediator complex subunit 29
19	61853.ENSNLEP00000015868	0.983	Mediator complex subunit 22
20	61853.ENSNLEP00000000301	0.982	Mediator of RNA polymerase II transcription subunit 13

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003824	0.853	catalytic activity
GO:0016740	0.790	transferase activity
GO:0061659	0.731	ubiquitin-like protein ligase activity
GO:0061630	0.724	ubiquitin protein ligase activity
GO:0140110	0.443	transcription regulator activity
GO:0003712	0.337	transcription coregulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0006807	0.993	nitrogen compound metabolic process
GO:0043170	0.993	macromolecule metabolic process
GO:0044237	0.986	cellular metabolic process
GO:0046483	0.940	heterocycle metabolic process
GO:0034641	0.933	cellular nitrogen compound metabolic process
GO:0009058	0.929	biosynthetic process
GO:0044249	0.922	cellular biosynthetic process
GO:0010467	0.921	gene expression
GO:1901360	0.916	organic cyclic compound metabolic process
GO:0006139	0.910	nucleobase-containing compound metabolic process
GO:0006351	0.901	DNA-templated transcription
GO:0050794	0.895	regulation of cellular process
GO:0019222	0.880	regulation of metabolic process
GO:0010468	0.858	regulation of gene expression
GO:0080090	0.857	regulation of primary metabolic process
GO:0006366	0.836	transcription by RNA polymerase II
GO:0051171	0.830	regulation of nitrogen compound metabolic process
GO:0031323	0.830	regulation of cellular metabolic process
GO:0051252	0.820	regulation of RNA metabolic process
GO:0009889	0.816	regulation of biosynthetic process
GO:0032501	0.786	multicellular organismal process
GO:0010556	0.767	regulation of macromolecule biosynthetic process
GO:0031326	0.767	regulation of cellular biosynthetic process
GO:0006355	0.759	regulation of DNA-templated transcription
GO:0032502	0.746	developmental process
GO:0098727	0.716	maintenance of cell number
GO:0006352	0.693	DNA-templated transcription initiation
GO:0035019	0.677	somatic stem cell population maintenance
GO:0006357	0.645	regulation of transcription by RNA polymerase II
GO:0070647	0.633	protein modification by small protein conjugation or removal
GO:0016567	0.482	protein ubiquitination
GO:0006367	0.476	transcription initiation at RNA polymerase II promoter
GO:0048518	0.357	positive regulation of biological process
GO:0048522	0.345	positive regulation of cellular process
GO:0010604	0.310	positive regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.998	protein-containing complex
GO:0140513	0.950	nuclear protein-containing complex
GO:0090575	0.919	RNA polymerase II transcription regulator complex
GO:1990234	0.870	transferase complex
GO:0140535	0.869	intracellular protein-containing complex
GO:0016604	0.800	nuclear body
GO:0070847	0.749	core mediator complex
GO:0016592	0.504	mediator complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.790	Transferases.

[back to server]