StarFunc result for job id O43520

User Input

>input (1251 residues)
MSTERDSETTFDEDSQPNDEVVPYSDDETEDELDDQGSAVEPEQNRVNREAEENREPFRK
ECTWQVKANDRKYHEQPHFMNTKFLCIKESKYANNAIKTYKYNAFTFIPMNLFEQFKRAA
NLYFLALLILQAVPQISTLAWYTTLVPLLVVLGVTAIKDLVDDVARHKMDKEINNRTCEV
IKDGRFKVAKWKEIQVGDVIRLKKNDFVPADILLLSSSEPNSLCYVETAELDGETNLKFK
MSLEITDQYLQREDTLATFDGFIECEEPNNRLDKFTGTLFWRNTSFPLDADKILLRGCVI
RNTDFCHGLVIFAGADTKIMKNSGKTRFKRTKIDYLMNYMVYTIFVVLILLSAGLAIGHA
YWEAQVGNSSWYLYDGEDDTPSYRGFLIFWGYIIVLNTMVPISLYVSVEVIRLGQSHFIN
WDLQMYYAEKDTPAKARTTTLNEQLGQIHYIFSDKTGTLTQNIMTFKKCCINGQIYGDHR
DASQHNHNKIEQVDFSWNTYADGKLAFYDHYLIEQIQSGKEPEVRQFFFLLAVCHTVMVD
RTDGQLNYQAASPDEGALVNAARNFGFAFLARTQNTITISELGTERTYNVLAILDFNSDR
KRMSIIVRTPEGNIKLYCKGADTVIYERLHRMNPTKQETQDALDIFANETLRTLCLCYKE
IEEKEFTEWNKKFMAASVASTNRDEALDKVYEEIEKDLILLGATAIEDKLQDGVPETISK
LAKADIKIWVLTGDKKETAENIGFACELLTEDTTICYGEDINSLLHARMENQRNRGGVYA
KFAPPVQESFFPPGGNRALIITGSWLNEILLEKKTKRNKILKLKFPRTEEERRMRTQSKR
RLEAKKEQRQKNFVDLACECSAVICCRVTPKQKAMVVDLVKRYKKAITLAIGDGANDVNM
IKTAHIGVGISGQEGMQAVMSSDYSFAQFRYLQRLLLVHGRWSYIRMCKFLRYFFYKNFA
FTLVHFWYSFFNGYSAQTAYEDWFITLYNVLYTSLPVLLMGLLDQDVSDKLSLRFPGLYI
VGQRDLLFNYKRFFVSLLHGVLTSMILFFIPLGAYLQTVGQDGEAPSDYQSFAVTIASAL
VITVNFQIGLDTSYWTFVNAFSIFGSIALYFGIMFDFHSAGIHVLFPSAFQFTGTASNAL
RQPYIWLTIILAVAVCLLPVVAIRFLSMTIWPSESDKIQKHRKRLKAEEQWQRRQQVFRR
GVSTRRSAYAFSHQRGYADLISSGRSIRKKRSPLDAIVADGTAEYRRTGDS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7py4A	0.834	0.934	0.000	1112	0.876	0.986	7py4A.pdb.gz	Autoinhibition and regulation by phosphoinositides of ATP8B1, a human lipid flippase associated with intrahepatic cholestatic disorders.
2	PDB:7vghB	0.870	0.918	0.000	1183	0.932	0.986	7vghB.pdb.gz	Structural insights into the activation of autoinhibited human lipid flippase ATP8B1 upon substrate binding.
3	AFDB:A3FIN4	0.845	0.892	0.000	1183	0.472	0.500	A3FIN4.pdb.gz	AT8B5_MOUSE Phospholipid-transporting ATPase FetA OS=Mus musculus OX=10090 GN=Atp8b5 PE=2 SV=1
4	AFDB:D4AA47	0.966	0.966	0.000	1251	0.936	0.936	D4AA47.pdb.gz	AT8B1_RAT Phospholipid-transporting ATPase IC OS=Rattus norvegicus OX=10116 GN=Atp8b1 PE=1 SV=2
5	AFDB:P98198	0.845	0.873	0.000	1209	0.511	0.529	P98198.pdb.gz	AT8B2_HUMAN Phospholipid-transporting ATPase ID OS=Homo sapiens OX=9606 GN=ATP8B2 PE=1 SV=2
6	AFDB:Q6UQ17	0.844	0.792	0.000	1335	0.473	0.443	Q6UQ17.pdb.gz	AT8B3_MOUSE Phospholipid-transporting ATPase IK OS=Mus musculus OX=10090 GN=Atp8b3 PE=1 SV=1
7	AFDB:Q7YXV5	0.842	0.829	0.000	1270	0.473	0.466	Q7YXV5.pdb.gz	Q7YXV5_CAEEL Phospholipid-transporting ATPase OS=Caenorhabditis elegans OX=6239 GN=tat-2 PE=1 SV=2
8	AFDB:Q8TF62	0.841	0.881	0.000	1192	0.517	0.543	Q8TF62.pdb.gz	AT8B4_HUMAN Probable phospholipid-transporting ATPase IM OS=Homo sapiens OX=9606 GN=ATP8B4 PE=1 SV=3
9	AFDB:Q9VGD4	0.831	0.606	0.000	1726	0.479	0.347	Q9VGD4.pdb.gz	Q9VGD4_DROME Phospholipid-transporting ATPase OS=Drosophila melanogaster OX=7227 GN=ATP8B PE=3 SV=2
10	AFDB:Q9NTI2	0.812	0.854	1.740E-96	1188	0.380	0.401	Q9NTI2.pdb.gz	AT8A2_HUMAN Phospholipid-transporting ATPase IB OS=Homo sapiens OX=9606 GN=ATP8A2 PE=1 SV=3
11	AFDB:P70704	0.780	0.837	1.103E-94	1164	0.375	0.403	P70704.pdb.gz	AT8A1_MOUSE Phospholipid-transporting ATPase IA OS=Mus musculus OX=10090 GN=Atp8a1 PE=1 SV=2
12	AFDB:Q9XIE6	0.797	0.822	1.201E-94	1213	0.369	0.380	Q9XIE6.pdb.gz	ALA3_ARATH Phospholipid-transporting ATPase 3 OS=Arabidopsis thaliana OX=3702 GN=ALA3 PE=1 SV=2
13	PDB:7kycA	0.779	0.825	2.365E-81	1178	0.331	0.351	7kycA.pdb.gz	Transport mechanism of P4 ATPase phosphatidylcholine flippases.
14	PDB:6rohA	0.755	0.846	3.131E-80	1112	0.351	0.395	6rohA.pdb.gz	Structure and autoregulation of a P4-ATPase lipid flippase.
15	PDB:7kyaA	0.772	0.820	6.740E-75	1174	0.339	0.361	7kyaA.pdb.gz	Transport mechanism of P4 ATPase phosphatidylcholine flippases.
16	PDB:6k7lA	0.722	0.902	7.219E-74	992	0.353	0.446	6k7lA.pdb.gz	Cryo-EM structures capture the transport cycle of the P4-ATPase flippase.
17	PDB:7bspA	0.625	0.746	9.958E-65	1028	0.278	0.339	7bspA.pdb.gz	Transport Cycle of Plasma Membrane Flippase ATP11C by Cryo-EM.
18	PDB:6lknA	0.706	0.822	3.240E-61	1064	0.284	0.334	6lknA.pdb.gz	Crystal structure of a human plasma membrane phospholipid flippase.
19	PDB:7rd6A	0.670	0.888	1.236E-59	929	0.234	0.315	7rd6A.pdb.gz	Structural basis of the P4B ATPase lipid flippase activity.
20	PDB:7bssA	0.561	0.837	7.041E-46	816	0.219	0.336	7bssA.pdb.gz	Transport Cycle of Plasma Membrane Flippase ATP11C by Cryo-EM.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0B4K669	980	1496	0.440	0.368	A0A0B4K669_DROME Phospholipid-transporting ATPase OS=Drosophila melanogaster OX=7227 GN=ATP8B PE=3 SV=1
2	A0A0B4LH22	986	1317	0.443	0.421	A0A0B4LH22_DROME Phospholipid-transporting ATPase OS=Drosophila melanogaster OX=7227 GN=ATP8B PE=3 SV=1
3	A0A1D8PJN3	636	1479	0.301	0.254	A0A1D8PJN3_CANAL Phospholipid-transporting ATPase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DNF1 PE=3 SV=1
4	A0A5K1VW70	1254	1190	0.508	0.534	A0A5K1VW70_HUMAN Phospholipid-transporting ATPase OS=Homo sapiens OX=9606 GN=ATP8B2 PE=1 SV=1
5	A0A8I5ZKC1	711	985	0.329	0.417	A0A8I5ZKC1_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a1 PE=1 SV=1
6	A0A8I5ZXX6	840	1164	0.373	0.400	A0A8I5ZXX6_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a1 PE=1 SV=1
7	A0A8I6AVY6	847	1164	0.376	0.404	A0A8I6AVY6_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a1 PE=1 SV=1
8	A0A8I6G2I8	712	978	0.328	0.419	A0A8I6G2I8_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a1 PE=1 SV=1
9	A3FIN4	1158	1183	0.479	0.506	AT8B5_MOUSE Phospholipid-transporting ATPase FetA OS=Mus musculus OX=10090 GN=Atp8b5 PE=2 SV=1
10	C7EXK4	859	1148	0.375	0.409	AT8A2_BOVIN Phospholipid-transporting ATPase IB OS=Bos taurus OX=9913 GN=ATP8A2 PE=1 SV=4
11	D4A3X6	852	1169	0.366	0.392	D4A3X6_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a2 PE=1 SV=3
12	D4AA47	2409	1251	0.936	0.936	AT8B1_RAT Phospholipid-transporting ATPase IC OS=Rattus norvegicus OX=10116 GN=Atp8b1 PE=1 SV=2
13	E9PEJ6	626	1191	0.313	0.329	E9PEJ6_HUMAN Phospholipid-transporting ATPase OS=Homo sapiens OX=9606 GN=ATP11A PE=1 SV=1
14	F1LUT4	714	984	0.330	0.420	F1LUT4_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a1 PE=1 SV=4
15	F4IE35	773	1185	0.371	0.392	F4IE35_ARATH Phospholipid-transporting ATPase OS=Arabidopsis thaliana OX=3702 GN=At1g26130 PE=1 SV=1
16	F4K8T6	575	1139	0.289	0.318	F4K8T6_ARATH Phospholipid-transporting ATPase OS=Arabidopsis thaliana OX=3702 GN=ALA2 PE=1 SV=1
17	H0Y547	565	935	0.277	0.371	H0Y547_HUMAN Phospholipid-transporting ATPase (Fragment) OS=Homo sapiens OX=9606 GN=ATP11A PE=1 SV=1
18	O36028	613	1367	0.297	0.272	ATCZ_SCHPO Phospholipid-transporting ATPase C4F10.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC4F10.16c PE=3 SV=1
19	O43520	2615	1251	1.000	1.000	AT8B1_HUMAN Phospholipid-transporting ATPase IC OS=Homo sapiens OX=9606 GN=ATP8B1 PE=1 SV=3
20	O94296	783	1258	0.370	0.368	ATC3_SCHPO Phospholipid-transporting ATPase C887.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC887.12 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13246 Cation_ATPase	1.5e-09	49.1	Cation transport ATPase (P-type)
2	PF00122 E1-E2_ATPase	1.4e-05	36.3	E1-E2 ATPase
3	PF00702 Hydrolase	1.4e-05	37.0	haloacid dehalogenase-like hydrolase
4	PF08282 Hydrolase_3	1.1	20.5	haloacid dehalogenase-like hydrolase
5	PF16212 PhoLip_ATPase_C	4.4e-82	287.2	Phospholipid-translocating P-type ATPase C-terminal
6	PF16209 PhoLip_ATPase_N	2.5e-22	89.7	Phospholipid-translocating ATPase N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000445359

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000230461	0.996	Cell cycle control protein 50A
2	9606.ENSP00000450842	0.930	Cell cycle control protein 50B
3	9606.ENSP00000263817	0.919	Bile salt export pump
4	9606.ENSP00000265723	0.821	Phosphatidylcholine translocator ABCB4
5	9606.ENSP00000254227	0.730	Nuclear receptor subfamily 0 group B member 2
6	9606.ENSP00000419663	0.688	Cell cycle control protein 50C
7	9606.ENSP00000354995	0.636	ATP-binding cassette sub-family G member 1
8	9606.ENSP00000359478	0.629	Canalicular multispecific organic anion transporter 1
9	9606.ENSP00000447149	0.627	Bile acid receptor
10	9606.ENSP00000363868	0.610	ATP-binding cassette sub-family A member 1
11	9606.ENSP00000260645	0.592	ATP-binding cassette sub-family G member 5
12	9606.ENSP00000349877	0.589	Manganese-transporting ATPase 13A1
13	9606.ENSP00000216540	0.584	Sodium/bile acid cotransporter
14	9606.ENSP00000245312	0.575	Ileal sodium/bile acid cotransporter
15	9606.ENSP00000303960	0.572	ATP-binding cassette sub-family C member 8
16	9606.ENSP00000413575	0.564	Peroxisomal carnitine O-octanoyltransferase
17	9606.ENSP00000376293	0.548	Oxysterol-binding protein-related protein 6
18	9606.ENSP00000269228	0.547	Niemann-Pick C1 protein
19	9606.ENSP00000272286	0.536	ATP-binding cassette sub-family G member 8
20	9606.ENSP00000438262	0.535	Tight junction protein ZO-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140333	0.999	glycerophospholipid flippase activity
GO:0008525	0.956	phosphatidylcholine transporter activity
GO:0015247	0.466	aminophospholipid flippase activity
GO:0140345	0.401	phosphatidylcholine flippase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0051179	0.997	localization
GO:0009987	0.990	cellular process
GO:0006810	0.990	transport
GO:0015914	0.980	phospholipid transport
GO:0065007	0.950	biological regulation
GO:0071704	0.570	organic substance metabolic process
GO:0050789	0.561	regulation of biological process
GO:0050794	0.470	regulation of cellular process
GO:0044238	0.388	primary metabolic process
GO:0065008	0.374	regulation of biological quality
GO:0050896	0.331	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.999	membrane-bounded organelle
GO:0005886	0.997	plasma membrane
GO:0012505	0.996	endomembrane system
GO:0005622	0.980	intracellular anatomical structure
GO:0043231	0.968	intracellular membrane-bounded organelle
GO:0005737	0.943	cytoplasm
GO:0032991	0.919	protein-containing complex
GO:0031974	0.915	membrane-enclosed lumen
GO:0070013	0.908	intracellular organelle lumen
GO:0098862	0.790	cluster of actin-based cell projections
GO:0042995	0.742	cell projection
GO:0120025	0.690	plasma membrane bounded cell projection
GO:0098590	0.670	plasma membrane region
GO:1990351	0.472	transporter complex
GO:0005634	0.472	nucleus
GO:0031090	0.447	organelle membrane
GO:0031981	0.443	nuclear lumen
GO:0031982	0.440	vesicle
GO:0098588	0.364	bounding membrane of organelle
GO:1990531	0.342	phospholipid-translocating ATPase complex
GO:0045177	0.331	apical part of cell

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.6.2.1	1.000	P-type phospholipid transporter.

[back to server]