StarFunc result for job id O43521

User Input

>input (198 residues)
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSP
QGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPP
CQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPR
MVILRLLRYIVRLVWRMH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43521	1.000	1.000	1.915E-30	198	1.000	1.000	O43521.pdb.gz	B2L11_HUMAN Bcl-2-like protein 11 OS=Homo sapiens OX=9606 GN=BCL2L11 PE=1 SV=1
2	AFDB:O54918	0.283	0.285	1.425E-24	196	0.874	0.883	O54918.pdb.gz	B2L11_MOUSE Bcl-2-like protein 11 OS=Mus musculus OX=10090 GN=Bcl2l11 PE=1 SV=1
3	AFDB:B8JM41	0.176	0.105	6.989E-2	394	0.192	0.096	B8JM41.pdb.gz	B8JM41_DANRE Basic leucine zipper nuclear factor 1 OS=Danio rerio OX=7955 GN=fe06a04 PE=4 SV=1
4	AFDB:A3KGV1	0.216	0.068	7.499E-2	830	0.141	0.034	A3KGV1.pdb.gz	ODFP2_MOUSE Outer dense fiber protein 2 OS=Mus musculus OX=10090 GN=Odf2 PE=1 SV=1
5	AFDB:P38749	0.181	0.115	8.633E-2	330	0.141	0.085	P38749.pdb.gz	YAP3_YEAST AP-1-like transcription factor YAP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YAP3 PE=1 SV=1
6	AFDB:Q6QNY0	0.174	0.170	8.633E-2	202	0.197	0.193	Q6QNY0.pdb.gz	BL1S3_HUMAN Biogenesis of lysosome-related organelles complex 1 subunit 3 OS=Homo sapiens OX=9606 GN=BLOC1S3 PE=1 SV=1
7	AFDB:Q9DAC5	0.125	0.092	8.633E-2	291	0.182	0.124	Q9DAC5.pdb.gz	Q9DAC5_MOUSE RIKEN cDNA 1700013H16 gene OS=Mus musculus OX=10090 GN=1700013H16Rik PE=1 SV=1
8	AFDB:A8MRU4	0.143	0.134	9.938E-2	215	0.172	0.158	A8MRU4.pdb.gz	A8MRU4_ARATH Integral membrane hemolysin-III-like protein OS=Arabidopsis thaliana OX=3702 GN=At2g45250 PE=1 SV=1
9	AFDB:Q5B4G8	0.187	0.125	9.938E-2	317	0.162	0.101	Q5B4G8.pdb.gz	Q5B4G8_EMENI BZIP transcription factor (Fcr3), putative (AFU_orthologue AFUA_2G02540) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_04562 PE=4 SV=1
10	AFDB:Q9C1W6	0.190	0.105	1.317E-1	395	0.116	0.058	Q9C1W6.pdb.gz	YN59_SCHPO Uncharacterized protein C713.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC713.09 PE=4 SV=1
11	PDB:7w59R	0.179	0.133	3.538	280	0.126	0.089	7w59R.pdb.gz	Mechanism of exon ligation by human spliceosome.
12	PDB:6n7pA	0.139	0.147	4.689	186	0.066	0.070	6n7pA.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.
13	PDB:5datsM	0.125	0.173	5.031	104	0.086	0.163	5datsM.pdb.gz	Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome
14	PDB:6cxcA	0.135	0.258	5.792	73	0.040	0.110	6cxcA.pdb.gz
15	PDB:7o4iW	0.102	0.067	5.792	312	0.101	0.064	7o4iW.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
16	PDB:6qz9C	0.103	0.281	6.668	71	0.056	0.155	6qz9C.pdb.gz
17	PDB:6rlbD	0.121	0.057	7.154	446	0.061	0.027	6rlbD.pdb.gz
18	PDB:6c0fD	0.117	0.121	7.676	190	0.045	0.047	6c0fD.pdb.gz	Modular assembly of the nucleolar pre-60S ribosomal subunit.
19	PDB:7enaq	0.110	0.049	8.236	555	0.040	0.014	7enaq.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
20	PDB:7pzyl	0.071	0.048	8.236	361	0.091	0.050	7pzyl.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43521	1.04e-146	407	198	1.000	1.000	B2L11_HUMAN Bcl-2-like protein 11 OS=Homo sapiens OX=9606 GN=BCL2L11 PE=1 SV=1
2	O54918	1.03e-113	323	196	0.874	0.883	B2L11_MOUSE Bcl-2-like protein 11 OS=Mus musculus OX=10090 GN=Bcl2l11 PE=1 SV=1
3	O88498	1.51e-111	318	196	0.859	0.867	B2L11_RAT Bcl-2-like protein 11 OS=Rattus norvegicus OX=10116 GN=Bcl2l11 PE=1 SV=1
4	E9Q2Z1	0.80	32.7	1453	0.141	0.019	CECR2_MOUSE Chromatin remodeling regulator CECR2 OS=Mus musculus OX=10090 GN=Cecr2 PE=1 SV=1
5	Q9VDX5	1.1	32.3	485	0.076	0.031	Q9VDX5_DROME Serine protease K12H4.7 OS=Drosophila melanogaster OX=7227 GN=Dmel\CG3739 PE=3 SV=2
6	P43681	4.3	30.4	627	0.121	0.038	ACHA4_HUMAN Neuronal acetylcholine receptor subunit alpha-4 OS=Homo sapiens OX=9606 GN=CHRNA4 PE=1 SV=2
7	Q2UY11	4.6	30.4	1141	0.106	0.018	COSA1_MOUSE Collagen alpha-1(XXVIII) chain OS=Mus musculus OX=10090 GN=Col28a1 PE=2 SV=1
8	F4KEP6	4.7	30.0	229	0.066	0.057	F4KEP6_ARATH AGAMOUS-like 71 OS=Arabidopsis thaliana OX=3702 GN=AGL71 PE=4 SV=2
9	Q9W2K0	4.7	30.0	219	0.081	0.073	Q9W2K0_DROME Uncharacterized protein OS=Drosophila melanogaster OX=7227 GN=Dmel\CG4286 PE=1 SV=1
10	Q03002	5.4	30.4	865	0.167	0.038	FRK1_YEAST Fatty acyl-CoA synthetase and RNA processing-associated kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FRK1 PE=1 SV=1
11	Q8R526	6.0	30.4	2615	0.157	0.012	PK1L1_MOUSE Polycystin-1-like protein 1 OS=Mus musculus OX=10090 GN=Pkd1l1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08945 Bclx_interact	5.2e-15	66.3	Bcl-x interacting, BH3 domain
2	PF06773 Bim_N	4.4e-16	69.7	Bim protein N-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000002811

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000011718	0.999	BCL2-like 1
2	61853.ENSNLEP00000012087	0.999	MCL1, BCL2 family apoptosis regulator
3	61853.ENSNLEP00000005703	0.996	BCL2 associated X, apoptosis regulator
4	61853.ENSNLEP00000010587	0.996	BCL2, apoptosis regulator
5	61853.ENSNLEP00000019011	0.988	Dynein, light chain, LC8-type 1
6	61853.ENSNLEP00000010169	0.981	BCL2-antagonist/killer 1
7	61853.ENSNLEP00000010806	0.981	BCL2-related protein A1
8	61853.ENSNLEP00000007888	0.972	BCL2-like 10 (apoptosis facilitator)
9	61853.ENSNLEP00000018241	0.972	BCL2-like 2
10	61853.ENSNLEP00000021003	0.949	DNA damage-inducible transcript 3 protein
11	61853.ENSNLEP00000018075	0.932	Beta-transducin repeat containing E3 ubiquitin protein ligase
12	61853.ENSNLEP00000015110	0.910	Forkhead box O3
13	61853.ENSNLEP00000009548	0.895	Counters the protective effect of Bcl-2.
14	61853.ENSNLEP00000000288	0.893	Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. MAP kinase subfamily
15	61853.ENSNLEP00000013240	0.876	Caspase 3, apoptosis-related cysteine peptidase
16	61853.ENSNLEP00000023520	0.862	Dynein, light chain, LC8-type 2
17	61853.ENSNLEP00000001356	0.823	Forkhead box O1
18	61853.ENSNLEP00000009264	0.808	Caspase 9, apoptosis-related cysteine peptidase
19	61853.ENSNLEP00000009435	0.805	BOK, BCL2 family apoptosis regulator
20	61853.ENSNLEP00000001323	0.800	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008017	1.000	microtubule binding
GO:0019899	0.413	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050794	0.998	regulation of cellular process
GO:0050896	0.997	response to stimulus
GO:0048518	0.995	positive regulation of biological process
GO:0048522	0.993	positive regulation of cellular process
GO:0051716	0.991	cellular response to stimulus
GO:0006915	0.988	apoptotic process
GO:0010604	0.988	positive regulation of macromolecule metabolic process
GO:0051173	0.987	positive regulation of nitrogen compound metabolic process
GO:0051247	0.979	positive regulation of protein metabolic process
GO:0007165	0.977	signal transduction
GO:0043085	0.975	positive regulation of catalytic activity
GO:0048856	0.962	anatomical structure development
GO:0010941	0.941	regulation of cell death
GO:0035556	0.940	intracellular signal transduction
GO:0030162	0.936	regulation of proteolysis
GO:0051336	0.930	regulation of hydrolase activity
GO:0042221	0.925	response to chemical
GO:0048583	0.921	regulation of response to stimulus
GO:0042981	0.919	regulation of apoptotic process
GO:0051345	0.915	positive regulation of hydrolase activity
GO:0052548	0.913	regulation of endopeptidase activity
GO:0045862	0.911	positive regulation of proteolysis
GO:0043065	0.903	positive regulation of apoptotic process
GO:0070887	0.901	cellular response to chemical stimulus
GO:0006950	0.898	response to stress
GO:0010033	0.895	response to organic substance
GO:0071310	0.885	cellular response to organic substance
GO:2000116	0.884	regulation of cysteine-type endopeptidase activity
GO:0010950	0.884	positive regulation of endopeptidase activity
GO:0023051	0.868	regulation of signaling
GO:0010646	0.868	regulation of cell communication
GO:0033554	0.868	cellular response to stress
GO:0043281	0.854	regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0009966	0.853	regulation of signal transduction
GO:0031323	0.852	regulation of cellular metabolic process
GO:2001056	0.851	positive regulation of cysteine-type endopeptidase activity
GO:0031329	0.830	regulation of cellular catabolic process
GO:0097190	0.819	apoptotic signaling pathway
GO:0048584	0.813	positive regulation of response to stimulus
GO:0048519	0.812	negative regulation of biological process
GO:0071495	0.810	cellular response to endogenous stimulus
GO:0048523	0.795	negative regulation of cellular process
GO:0023056	0.773	positive regulation of signaling
GO:0010647	0.773	positive regulation of cell communication
GO:0051128	0.756	regulation of cellular component organization
GO:0009967	0.756	positive regulation of signal transduction
GO:0034976	0.755	response to endoplasmic reticulum stress
GO:0043280	0.696	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:1902531	0.678	regulation of intracellular signal transduction
GO:0010506	0.635	regulation of autophagy
GO:0071396	0.615	cellular response to lipid
GO:0071407	0.605	cellular response to organic cyclic compound
GO:0032501	0.602	multicellular organismal process
GO:0080134	0.573	regulation of response to stress
GO:0031325	0.571	positive regulation of cellular metabolic process
GO:0097193	0.538	intrinsic apoptotic signaling pathway
GO:0033043	0.529	regulation of organelle organization
GO:0071840	0.525	cellular component organization or biogenesis
GO:1902533	0.504	positive regulation of intracellular signal transduction
GO:0016043	0.480	cellular component organization
GO:0080135	0.466	regulation of cellular response to stress
GO:0006974	0.456	cellular response to DNA damage stimulus
GO:0009892	0.451	negative regulation of metabolic process
GO:0008152	0.445	metabolic process
GO:0051130	0.425	positive regulation of cellular component organization
GO:0010821	0.404	regulation of mitochondrion organization
GO:0048513	0.395	animal organ development
GO:0007166	0.389	cell surface receptor signaling pathway
GO:2001233	0.375	regulation of apoptotic signaling pathway
GO:0007275	0.370	multicellular organism development
GO:0008630	0.362	intrinsic apoptotic signaling pathway in response to DNA damage
GO:0010468	0.352	regulation of gene expression
GO:0071704	0.336	organic substance metabolic process
GO:0048731	0.315	system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0032991	0.998	protein-containing complex
GO:0016020	0.998	membrane
GO:0005829	0.998	cytosol
GO:0031090	0.940	organelle membrane
GO:0043232	0.911	intracellular non-membrane-bounded organelle
GO:0098588	0.849	bounding membrane of organelle
GO:0031966	0.781	mitochondrial membrane
GO:0005634	0.725	nucleus
GO:0097136	0.684	Bcl-2 family protein complex
GO:0005856	0.673	cytoskeleton
GO:0015630	0.636	microtubule cytoskeleton
GO:0070013	0.619	intracellular organelle lumen
GO:0019867	0.607	outer membrane
GO:0031968	0.599	organelle outer membrane
GO:0005741	0.563	mitochondrial outer membrane
GO:0099080	0.406	supramolecular complex
GO:0097141	0.370	BIM-BCL-2 complex
GO:0097140	0.370	BIM-BCL-xl complex
GO:0099512	0.349	supramolecular fiber
GO:0012505	0.330	endomembrane system
GO:0099513	0.327	polymeric cytoskeletal fiber

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]