StarFunc result for job id O43524

User Input

>input (673 residues)
MAEAPASPAPLSPLEVELDPEFEPQSRPRSCTWPLQRPELQASPAKPSGETAADSMIPEE
EDDEDDEDGGGRAGSAMAIGGGGGSGTLGSGLLLEDSARVLAPGGQDPGSGPATAAGGLS
GGTQALLQPQQPLPPPQPGAAGGSGQPRKCSSRRNAWGNLSYADLITRAIESSPDKRLTL
SQIYEWMVRCVPYFKDKGDSNSSAGWKNSIRHNLSLHSRFMRVQNEGTGKSSWWIINPDG
GKSGKAPRRRAVSMDNSNKYTKSRGRAAKKKAALQTAPESADDSPSQLSKWPGSPTSRSS
DELDAWTDFRSRTNSNASTVSGRLSPIMASTELDEVQDDDAPLSPMLYSSSASLSPSVSK
PCTVELPRLTDMAGTMNLNDGLTENLMDDLLDNITLPPSQPSPTGGLMQRSSSFPYTTKG
SGLGSPTSSFNSTVFGPSSLNSLRQSPMQTIQENKPATFSSMSHYGNQTLQDLLTSDSLS
HSDVMMTQSDPLMSQASTAVSAQNSRRNVMLRNDPMMSFAAQPNQGSLVNQNLLHHQHQT
QGALGGSRALSNSVSNMGLSESSSLGSAKHQQQSPVSQSMQTLSDSLSGSSLYSTSANLP
VMGHEKFPSDLDLDMFNGSLECDMESIIRSELMDADGLDFNFDSLISTQNVVGLNVGNFT
GAKQASSQSWVPG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43524	0.999	0.999	6.068E-97	673	1.000	1.000	O43524.pdb.gz	FOXO3_HUMAN Forkhead box protein O3 OS=Homo sapiens OX=9606 GN=FOXO3 PE=1 SV=1
2	AFDB:F1NNE8	0.179	0.182	9.679E-73	660	0.822	0.838	F1NNE8.pdb.gz	F1NNE8_CHICK Forkhead box O3 OS=Gallus gallus OX=9031 GN=FOXO3 PE=2 SV=4
3	AFDB:Q5I0F7	0.196	0.203	1.884E-52	643	0.557	0.583	Q5I0F7.pdb.gz	Q5I0F7_DANRE Forkhead box O3A OS=Danio rerio OX=7955 GN=fb50g02 PE=2 SV=1
4	AFDB:B3DGQ4	0.177	0.181	1.997E-49	651	0.577	0.596	B3DGQ4.pdb.gz
5	AFDB:A4L7N3	0.222	0.225	4.814E-41	662	0.461	0.468	A4L7N3.pdb.gz	FOXO1_PIG Forkhead box protein O1 OS=Sus scrofa OX=9823 GN=FOXO1 PE=2 SV=1
6	AFDB:A3RK74	0.194	0.198	2.689E-37	652	0.422	0.436	A3RK74.pdb.gz	FX1AA_DANRE Forkhead box protein O1-A OS=Danio rerio OX=7955 GN=foxo1a PE=2 SV=1
7	AFDB:A3RK75	0.224	0.236	2.357E-35	629	0.374	0.401	A3RK75.pdb.gz	FX1AB_DANRE Forkhead box protein O1-B OS=Danio rerio OX=7955 GN=foxo1b PE=2 SV=1
8	PDB:2hdcA	0.102	0.551	5.348E-5	97	0.056	0.392	2hdcA.pdb.gz	Dynamic DNA contacts observed in the NMR structure of winged helix protein-DNA complex.
9	AFDB:Q9W3Q5	0.121	0.069	1.175E-4	1268	0.193	0.103	Q9W3Q5.pdb.gz	Q9W3Q5_DROME Checkpoint suppressor 1-like, isoform A OS=Drosophila melanogaster OX=7227 GN=CHES-1-like PE=4 SV=4
10	AFDB:P40656	0.079	0.080	4.217E-4	669	0.146	0.146	P40656.pdb.gz	SOX14_DROME Putative transcription factor SOX-14 OS=Drosophila melanogaster OX=7227 GN=Sox14 PE=2 SV=3
11	AFDB:Q9EQY2	0.082	0.093	7.032E-4	579	0.123	0.143	Q9EQY2.pdb.gz
12	PDB:6qpqD	0.092	0.558	2.992E-2	82	0.010	0.085	6qpqD.pdb.gz
13	PDB:6labV	0.095	0.428	5.669E-2	109	0.025	0.156	6labV.pdb.gz	Engineering nucleosomes for generating diverse chromatin assemblies.
14	PDB:6zmiCE	0.090	0.673	7.804E-2	72	0.013	0.125	6zmiCE.pdb.gz	Structural basis for translational shutdown and immune evasion by the Nsp1 protein of SARS-CoV-2.
15	PDB:3euhC	0.094	0.264	1.008E-1	206	0.022	0.073	3euhC.pdb.gz
16	PDB:6mzlA	0.074	0.099	1.145E-1	472	0.031	0.044	6mzlA.pdb.gz
17	PDB:6i6mB	0.086	0.151	1.909E-1	357	0.015	0.028	6i6mB.pdb.gz	Structure of Papaver somniferum O-Methyltransferase 1 Reveals Initiation of Noscapine Biosynthesis with Implications for Plant Natural Product Methylation
18	PDB:2fe3B	0.086	0.358	2.035E-1	143	0.015	0.070	2fe3B.pdb.gz	Crystal structure of the apo-PerR-Zn protein from Bacillus subtilis.
19	PDB:6iwtA	0.079	0.137	2.170E-1	346	0.019	0.038	6iwtA.pdb.gz
20	PDB:5h3rA	0.075	0.290	2.987E-1	141	0.012	0.057	5h3rA.pdb.gz	Structural characterization of the DNA-binding mechanism underlying the copper(II)-sensing MarR transcriptional regulator.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3ZBQ1	0.0	1137	672	0.945	0.946	D3ZBQ1_RAT Forkhead box O3 OS=Rattus norvegicus OX=10116 GN=Foxo3 PE=1 SV=1
2	F1NNE8	0.0	899	660	0.700	0.714	F1NNE8_CHICK Forkhead box O3 OS=Gallus gallus OX=9031 GN=FOXO3 PE=2 SV=4
3	O43524	0.0	1359	673	1.000	1.000	FOXO3_HUMAN Forkhead box protein O3 OS=Homo sapiens OX=9606 GN=FOXO3 PE=1 SV=1
4	Q5I0F7	0.0	575	643	0.568	0.594	Q5I0F7_DANRE Forkhead box O3A OS=Danio rerio OX=7955 GN=fb50g02 PE=2 SV=1
5	Q9W7F8	0.0	582	651	0.581	0.601	Q9W7F8_DANRE Forkhead box protein O3 OS=Danio rerio OX=7955 GN=fkhr PE=2 SV=1
6	Q9WVH4	0.0	1112	672	0.947	0.948	FOXO3_MOUSE Forkhead box protein O3 OS=Mus musculus OX=10090 GN=Foxo3 PE=1 SV=1
7	F1RME6	1.23e-155	466	662	0.483	0.491	F1RME6_PIG Forkhead box protein O1 OS=Sus scrofa OX=9823 GN=FOXO1 PE=4 SV=2
8	A4L7N3	2.04e-152	458	662	0.467	0.474	FOXO1_PIG Forkhead box protein O1 OS=Sus scrofa OX=9823 GN=FOXO1 PE=2 SV=1
9	Q12778	2.80e-139	424	655	0.388	0.398	FOXO1_HUMAN Forkhead box protein O1 OS=Homo sapiens OX=9606 GN=FOXO1 PE=1 SV=2
10	G3V7R4	4.36e-138	421	649	0.380	0.394	FOXO1_RAT Forkhead box protein O1 OS=Rattus norvegicus OX=10116 GN=Foxo1 PE=1 SV=1
11	Q9R1E0	2.19e-137	419	652	0.380	0.393	FOXO1_MOUSE Forkhead box protein O1 OS=Mus musculus OX=10090 GN=Foxo1 PE=1 SV=2
12	A3RK75	2.02e-122	379	629	0.398	0.426	FX1AB_DANRE Forkhead box protein O1-B OS=Danio rerio OX=7955 GN=foxo1b PE=2 SV=1
13	A3RK74	1.70e-115	362	652	0.383	0.396	FX1AA_DANRE Forkhead box protein O1-A OS=Danio rerio OX=7955 GN=foxo1a PE=2 SV=1
14	Q9WVH3	1.63e-106	334	505	0.361	0.481	FOXO4_MOUSE Forkhead box protein O4 OS=Mus musculus OX=10090 GN=Foxo4 PE=1 SV=1
15	P98177	1.82e-97	310	505	0.314	0.418	FOXO4_HUMAN Forkhead box protein O4 OS=Homo sapiens OX=9606 GN=FOXO4 PE=1 SV=5
16	Q70KY4	3.71e-89	290	559	0.257	0.309	FOXO6_MOUSE Forkhead box protein O6 OS=Mus musculus OX=10090 GN=Foxo6 PE=1 SV=1
17	D4A433	2.45e-85	279	505	0.259	0.345	D4A433_RAT Forkhead box O4 OS=Rattus norvegicus OX=10116 GN=Foxo4 PE=1 SV=1
18	A8MYZ6	3.99e-76	254	492	0.212	0.291	FOXO6_HUMAN Forkhead box protein O6 OS=Homo sapiens OX=9606 GN=FOXO6 PE=1 SV=1
19	A0A096MJF0	3.24e-71	240	450	0.229	0.342	A0A096MJF0_RAT Forkhead box O4 OS=Rattus norvegicus OX=10116 GN=Foxo4 PE=1 SV=2
20	Q95V55	5.95e-63	222	613	0.190	0.209	FOXO_DROME Forkhead box protein O OS=Drosophila melanogaster OX=7227 GN=foxo PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00250 Forkhead	8.3e-22	88.5	Forkhead domain
2	PF16676 FOXO-TAD	1.3e-18	78.5	Transactivation domain of FOXO protein family
3	PF16675 FOXO_KIX_bdg	3.5e-30	115.4	KIX-binding domain of forkhead box O, CR2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000385824

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000212015	0.999	NAD-dependent protein deacetylase sirtuin-1
2	9606.ENSP00000266970	0.999	Cyclin-dependent kinase 2
3	9606.ENSP00000344456	0.999	Catenin beta-1
4	9606.ENSP00000372191	0.999	NAD-dependent protein deacetylase sirtuin-3, mitochondrial
5	9606.ENSP00000379287	0.999	14-3-3 protein zeta/delta
6	9606.ENSP00000451828	0.999	RAC-alpha serine/threonine-protein kinase
7	9606.ENSP00000258149	0.997	E3 ubiquitin-protein ligase Mdm2
8	9606.ENSP00000269305	0.997	Cellular tumor antigen p53
9	9606.ENSP00000263253	0.996	Histone acetyltransferase p300
10	9606.ENSP00000479618	0.996	Myc proto-oncogene protein
11	9606.ENSP00000341551	0.995	Mothers against decapentaplegic homolog 4
12	9606.ENSP00000262160	0.993	Mothers against decapentaplegic homolog 2
13	9606.ENSP00000361930	0.993	14-3-3 protein beta/alpha
14	9606.ENSP00000375892	0.993	RAC-beta serine/threonine-protein kinase
15	9606.ENSP00000376943	0.993	Bcl-2-like protein 11
16	9606.ENSP00000263826	0.992	RAC-gamma serine/threonine-protein kinase
17	9606.ENSP00000264335	0.992	14-3-3 protein epsilon
18	9606.ENSP00000264867	0.992	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
19	9606.ENSP00000278616	0.990	Serine-protein kinase ATM
20	9606.ENSP00000332973	0.989	Mothers against decapentaplegic homolog 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000981	1.000	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:1990837	0.998	sequence-specific double-stranded DNA binding
GO:0019899	0.997	enzyme binding
GO:0001217	0.962	DNA-binding transcription repressor activity
GO:0019901	0.933	protein kinase binding
GO:0001227	0.928	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0008013	0.911	beta-catenin binding
GO:0008134	0.770	transcription factor binding
GO:0034246	0.562	mitochondrial transcription factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0050896	0.991	response to stimulus
GO:0009987	0.989	cellular process
GO:0048523	0.989	negative regulation of cellular process
GO:0031325	0.987	positive regulation of cellular metabolic process
GO:0051716	0.984	cellular response to stimulus
GO:0031326	0.983	regulation of cellular biosynthetic process
GO:0010556	0.981	regulation of macromolecule biosynthetic process
GO:0019219	0.981	regulation of nucleobase-containing compound metabolic process
GO:0071704	0.975	organic substance metabolic process
GO:0042221	0.975	response to chemical
GO:0010604	0.972	positive regulation of macromolecule metabolic process
GO:0006950	0.968	response to stress
GO:0006355	0.968	regulation of DNA-templated transcription
GO:0044238	0.965	primary metabolic process
GO:0006357	0.962	regulation of transcription by RNA polymerase II
GO:0009891	0.961	positive regulation of biosynthetic process
GO:0070887	0.953	cellular response to chemical stimulus
GO:0010033	0.939	response to organic substance
GO:0048583	0.937	regulation of response to stimulus
GO:0050793	0.923	regulation of developmental process
GO:0010605	0.913	negative regulation of macromolecule metabolic process
GO:0010557	0.913	positive regulation of macromolecule biosynthetic process
GO:0031324	0.893	negative regulation of cellular metabolic process
GO:0051173	0.882	positive regulation of nitrogen compound metabolic process
GO:0044237	0.878	cellular metabolic process
GO:0009890	0.866	negative regulation of biosynthetic process
GO:0031327	0.862	negative regulation of cellular biosynthetic process
GO:0051172	0.858	negative regulation of nitrogen compound metabolic process
GO:0007154	0.849	cell communication
GO:0033554	0.844	cellular response to stress
GO:0045893	0.837	positive regulation of DNA-templated transcription
GO:0043170	0.819	macromolecule metabolic process
GO:0006807	0.815	nitrogen compound metabolic process
GO:0010941	0.806	regulation of cell death
GO:0032502	0.776	developmental process
GO:0007165	0.770	signal transduction
GO:0051239	0.755	regulation of multicellular organismal process
GO:0010558	0.751	negative regulation of macromolecule biosynthetic process
GO:0009719	0.726	response to endogenous stimulus
GO:0051246	0.699	regulation of protein metabolic process
GO:1901700	0.663	response to oxygen-containing compound
GO:0071310	0.658	cellular response to organic substance
GO:0045892	0.656	negative regulation of DNA-templated transcription
GO:0042981	0.596	regulation of apoptotic process
GO:0045595	0.568	regulation of cell differentiation
GO:0045944	0.566	positive regulation of transcription by RNA polymerase II
GO:0023051	0.554	regulation of signaling
GO:0010646	0.547	regulation of cell communication
GO:0009605	0.519	response to external stimulus
GO:0009966	0.519	regulation of signal transduction
GO:0048856	0.475	anatomical structure development
GO:0032501	0.465	multicellular organismal process
GO:1901564	0.440	organonitrogen compound metabolic process
GO:0042127	0.436	regulation of cell population proliferation
GO:0019538	0.433	protein metabolic process
GO:0000122	0.427	negative regulation of transcription by RNA polymerase II
GO:0043412	0.426	macromolecule modification
GO:0007166	0.418	cell surface receptor signaling pathway
GO:0009725	0.409	response to hormone
GO:0036211	0.408	protein modification process
GO:0051240	0.379	positive regulation of multicellular organismal process
GO:0071840	0.364	cellular component organization or biogenesis
GO:2000026	0.356	regulation of multicellular organismal development
GO:0080134	0.354	regulation of response to stress
GO:0051094	0.350	positive regulation of developmental process
GO:0071495	0.340	cellular response to endogenous stimulus
GO:0031667	0.321	response to nutrient levels
GO:0002682	0.320	regulation of immune system process
GO:1901701	0.312	cellular response to oxygen-containing compound
GO:0034641	0.310	cellular nitrogen compound metabolic process
GO:1901360	0.303	organic cyclic compound metabolic process
GO:1901698	0.301	response to nitrogen compound
GO:0009628	0.300	response to abiotic stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0032991	0.969	protein-containing complex
GO:0005739	0.930	mitochondrion
GO:0016020	0.813	membrane
GO:0031090	0.732	organelle membrane
GO:0031967	0.673	organelle envelope
GO:0098588	0.627	bounding membrane of organelle
GO:0005740	0.466	mitochondrial envelope
GO:0031966	0.464	mitochondrial membrane
GO:0031968	0.459	organelle outer membrane
GO:0005759	0.459	mitochondrial matrix
GO:0005741	0.446	mitochondrial outer membrane
GO:0140513	0.386	nuclear protein-containing complex
GO:0090571	0.369	RNA polymerase II transcription repressor complex
GO:0012505	0.330	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]