StarFunc result for job id O43541

User Input

>input (496 residues)
MFRSKRSGLVRRLWRSRVVPDREEGGSGGGGGGDEDGSLGSRAEPAPRAREGGGCGRSEV
RPVAPRRPRDAVGQRGAQGAGRRRRAGGPPRPMSEPGAGAGSSLLDVAEPGGPGWLPESD
CETVTCCLFSERDAAGAPRDASDPLAGAALEPAGGGRSREARSRLLLLEQELKTVTYSLL
KRLKERSLDTLLEAVESRGGVPGGCVLVPRADLRLGGQPAPPQLLLGRLFRWPDLQHAVE
LKPLCGCHSFAAAADGPTVCCNPYHFSRLCGPESPPPPYSRLSPRDEYKPLDLSDSTLSY
TETEATNSLITAPGEFSDASMSPDATKPSHWCSVAYWEHRTRVGRLYAVYDQAVSIFYDL
PQGSGFCLGQLNLEQRSESVRRTRSKIGFGILLSKEPDGVWAYNRGEHPIFVNSPTLDAP
GGRALVVRKVPPGYSIKVFDFERSGLQHAPEPDAADGPYDPNSVRISFAKGWGPCYSRQF
ITSCPCWLEILLNNPR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43541	1.000	1.000	1.572E-92	496	1.000	1.000	O43541.pdb.gz	SMAD6_HUMAN Mothers against decapentaplegic homolog 6 OS=Homo sapiens OX=9606 GN=SMAD6 PE=1 SV=2
2	AFDB:A0A1D5PNY8	0.598	0.754	9.205E-46	388	0.429	0.549	A0A1D5PNY8.pdb.gz	A0A1D5PNY8_CHICK Mothers against decapentaplegic homolog OS=Gallus gallus OX=9031 GN=SMAD7 PE=3 SV=1
3	AFDB:Q1ED26	0.340	0.581	1.025E-33	286	0.312	0.542	Q1ED26.pdb.gz
4	AFDB:O15968	0.506	0.449	9.754E-29	568	0.308	0.269	O15968.pdb.gz	O15968_DROME Mothers against decapentaplegic homolog OS=Drosophila melanogaster OX=7227 GN=Dad PE=2 SV=1
5	AFDB:Q8RWK8	0.077	0.066	4.327E-2	608	0.121	0.099	Q8RWK8.pdb.gz	COIL_ARATH Coilin OS=Arabidopsis thaliana OX=3702 GN=COIL PE=1 SV=1
6	PDB:6z4eA	0.086	0.182	1.679E-1	207	0.016	0.039	6z4eA.pdb.gz
7	PDB:5z56X	0.152	0.410	3.634E-1	159	0.032	0.101	5z56X.pdb.gz	Structure of the human activated spliceosome in three conformational states.
8	PDB:2iglA	0.076	0.247	4.092E-1	116	0.030	0.129	2iglA.pdb.gz
9	AFDB:Q5EAP5	0.082	0.061	5.243E-1	734	0.091	0.061	Q5EAP5.pdb.gz	RFX2_DANRE DNA-binding protein RFX2 OS=Danio rerio OX=7955 GN=rfx2 PE=2 SV=1
10	PDB:3gd1E	0.078	0.118	5.507E-1	300	0.034	0.057	3gd1E.pdb.gz	Structure of an arrestin2-clathrin complex reveals a novel clathrin binding domain that modulates receptor trafficking
11	AFDB:Q3UR85	0.082	0.047	5.564E-1	1138	0.145	0.063	Q3UR85.pdb.gz	MYRF_MOUSE Myelin regulatory factor OS=Mus musculus OX=10090 GN=Myrf PE=1 SV=2
12	PDB:2kb3A	0.152	0.452	5.844E-1	143	0.032	0.112	2kb3A.pdb.gz
13	PDB:7u7nC	0.079	0.159	5.844E-1	200	0.048	0.120	7u7nC.pdb.gz
14	PDB:1j0hA	0.073	0.063	6.202E-1	588	0.020	0.017	1j0hA.pdb.gz	Three-dimensional Structure and Substrate Binding of Bacillus stearothermophilus Neopullulanase
15	PDB:7dvqX	0.166	0.469	6.202E-1	156	0.024	0.077	7dvqX.pdb.gz	Structure of the activated human minor spliceosome.
16	PDB:6xwvD	0.080	0.208	6.582E-1	123	0.028	0.114	6xwvD.pdb.gz	Structural basis for centromere maintenance by Drosophila CENP-A chaperone CAL1.
17	PDB:2mspA	0.092	0.289	7.412E-1	124	0.028	0.113	2mspA.pdb.gz
18	AFDB:Q59PA6	0.061	0.041	8.948E-1	779	0.117	0.074	Q59PA6.pdb.gz	Q59PA6_CANAL Vac7p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=VAC7 PE=4 SV=1
19	AFDB:Q5VRW2	0.070	0.069	9.496E-1	507	0.141	0.138	Q5VRW2.pdb.gz	NOH1_ORYSJ Transcription factor NIGTH1 OS=Oryza sativa subsp. japonica OX=39947 GN=NHO1 PE=1 SV=2
20	AFDB:Q8N157	0.104	0.053	1.621	1196	0.131	0.054	Q8N157.pdb.gz	AHI1_HUMAN Jouberin OS=Homo sapiens OX=9606 GN=AHI1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C3U1W5	0.0	596	431	0.645	0.742	C3U1W5_CHICK Mothers against decapentaplegic homolog OS=Gallus gallus OX=9031 GN=Smad6 PE=2 SV=1
2	D3ZAQ2	0.0	845	495	0.927	0.929	D3ZAQ2_RAT Mothers against decapentaplegic homolog OS=Rattus norvegicus OX=10116 GN=Smad6 PE=3 SV=4
3	O35182	0.0	869	495	0.925	0.927	SMAD6_MOUSE Mothers against decapentaplegic homolog 6 OS=Mus musculus OX=10090 GN=Smad6 PE=1 SV=1
4	O43541	0.0	989	496	1.000	1.000	SMAD6_HUMAN Mothers against decapentaplegic homolog 6 OS=Homo sapiens OX=9606 GN=SMAD6 PE=1 SV=2
5	Q9W734	0.0	596	431	0.653	0.752	SMAD6_CHICK Mothers against decapentaplegic homolog 6 OS=Gallus gallus OX=9031 GN=SMAD6 PE=2 SV=1
6	O15105	2.45e-106	325	426	0.367	0.427	SMAD7_HUMAN Mothers against decapentaplegic homolog 7 OS=Homo sapiens OX=9606 GN=SMAD7 PE=1 SV=1
7	A0A1D5PNY8	5.15e-106	323	388	0.361	0.461	A0A1D5PNY8_CHICK Mothers against decapentaplegic homolog OS=Gallus gallus OX=9031 GN=SMAD7 PE=3 SV=1
8	C3U1W4	5.27e-106	323	384	0.361	0.466	C3U1W4_CHICK Mothers against decapentaplegic homolog (Fragment) OS=Gallus gallus OX=9031 GN=Smad7a PE=2 SV=1
9	A2VCX3	8.50e-106	317	233	0.323	0.687	A2VCX3_DANRE Smad6a protein (Fragment) OS=Danio rerio OX=7955 GN=smad6a PE=2 SV=1
10	O88406	8.75e-106	323	426	0.367	0.427	SMAD7_RAT Mothers against decapentaplegic homolog 7 OS=Rattus norvegicus OX=10116 GN=Smad7 PE=2 SV=2
11	O35253	8.62e-105	321	426	0.365	0.425	SMAD7_MOUSE Mothers against decapentaplegic homolog 7 OS=Mus musculus OX=10090 GN=Smad7 PE=1 SV=1
12	Q8SZT4	3.30e-43	162	507	0.256	0.250	Q8SZT4_DROME Mothers against decapentaplegic homolog OS=Drosophila melanogaster OX=7227 GN=Dad PE=2 SV=1
13	Q5U110	7.27e-43	162	568	0.256	0.224	Q5U110_DROME Mothers against decapentaplegic homolog OS=Drosophila melanogaster OX=7227 GN=Dad PE=2 SV=1
14	A0A6H2EEY2	1.13e-42	162	665	0.256	0.191	A0A6H2EEY2_DROME Mothers against decapentaplegic homolog OS=Drosophila melanogaster OX=7227 GN=Dad PE=3 SV=1
15	O15968	1.82e-42	160	568	0.256	0.224	O15968_DROME Mothers against decapentaplegic homolog OS=Drosophila melanogaster OX=7227 GN=Dad PE=2 SV=1
16	K7EIU8	1.28e-36	142	456	0.240	0.261	K7EIU8_HUMAN Mothers against decapentaplegic homolog OS=Homo sapiens OX=9606 GN=SMAD4 PE=1 SV=1
17	Q8AY15	5.34e-36	140	425	0.226	0.264	Q8AY15_DANRE Mothers against decapentaplegic homolog OS=Danio rerio OX=7955 GN=madh3 PE=2 SV=1
18	P42003	7.02e-36	140	455	0.236	0.257	MAD_DROME Protein mothers against dpp OS=Drosophila melanogaster OX=7227 GN=Mad PE=1 SV=1
19	P84022	2.68e-35	138	425	0.226	0.264	SMAD3_HUMAN Mothers against decapentaplegic homolog 3 OS=Homo sapiens OX=9606 GN=SMAD3 PE=1 SV=1
20	P84025	2.68e-35	138	425	0.226	0.264	SMAD3_RAT Mothers against decapentaplegic homolog 3 OS=Rattus norvegicus OX=10116 GN=Smad3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03165 MH1	1.3e-23	94.5	MH1 domain
2	PF03166 MH2	3.3e-52	188.7	MH2 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000288840

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354621	0.999	E3 ubiquitin-protein ligase SMURF1
2	9606.ENSP00000360493	0.993	Runt-related transcription factor 2
3	9606.ENSP00000364133	0.992	TGF-beta receptor type-1
4	9606.ENSP00000401907	0.992	Bone morphogenetic protein receptor type-1B
5	9606.ENSP00000426568	0.989	Mothers against decapentaplegic homolog 1
6	9606.ENSP00000361107	0.986	Bone morphogenetic protein receptor type-1A
7	9606.ENSP00000363708	0.984	Bone morphogenetic protein receptor type-2
8	9606.ENSP00000262435	0.982	E3 ubiquitin-protein ligase SMURF2
9	9606.ENSP00000379204	0.971	Bone morphogenetic protein 7
10	9606.ENSP00000358335	0.966	Mitogen-activated protein kinase kinase kinase 7
11	9606.ENSP00000341551	0.965	Mothers against decapentaplegic homolog 4
12	9606.ENSP00000355896	0.965	Transforming growth factor beta-2
13	9606.ENSP00000351905	0.963	TGF-beta receptor type-2
14	9606.ENSP00000238682	0.961	Transforming growth factor beta-3
15	9606.ENSP00000221930	0.955	Transforming growth factor beta-1
16	9606.ENSP00000040584	0.954	Homeobox protein Hox-C8
17	9606.ENSP00000441954	0.953	Mothers against decapentaplegic homolog 5
18	9606.ENSP00000262158	0.952	Mothers against decapentaplegic homolog 7
19	9606.ENSP00000216160	0.944	TGF-beta-activated kinase 1 and MAP3K7-binding protein 1
20	9606.ENSP00000334458	0.937	Transcription factor GATA-4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0003677	0.989	DNA binding
GO:0019899	0.947	enzyme binding
GO:0000976	0.939	transcription cis-regulatory region binding
GO:0031625	0.849	ubiquitin protein ligase binding
GO:0046332	0.752	SMAD binding
GO:0005102	0.747	signaling receptor binding
GO:0042802	0.679	identical protein binding
GO:0005160	0.672	transforming growth factor beta receptor binding
GO:0070411	0.617	I-SMAD binding
GO:0070412	0.582	R-SMAD binding
GO:0034713	0.568	type I transforming growth factor beta receptor binding
GO:0070698	0.567	type I activin receptor binding
GO:0098772	0.555	molecular function regulator activity
GO:0070410	0.550	co-SMAD binding
GO:0140416	0.546	transcription regulator inhibitor activity
GO:0003682	0.459	chromatin binding
GO:0140110	0.365	transcription regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0050896	0.994	response to stimulus
GO:0032501	0.990	multicellular organismal process
GO:0048856	0.990	anatomical structure development
GO:0009987	0.986	cellular process
GO:0050794	0.985	regulation of cellular process
GO:0009966	0.979	regulation of signal transduction
GO:0048519	0.977	negative regulation of biological process
GO:0051239	0.975	regulation of multicellular organismal process
GO:0007275	0.969	multicellular organism development
GO:0031324	0.964	negative regulation of cellular metabolic process
GO:0010468	0.945	regulation of gene expression
GO:0051716	0.943	cellular response to stimulus
GO:0050793	0.932	regulation of developmental process
GO:0048731	0.921	system development
GO:0080090	0.920	regulation of primary metabolic process
GO:0048513	0.916	animal organ development
GO:0051171	0.914	regulation of nitrogen compound metabolic process
GO:0048518	0.903	positive regulation of biological process
GO:0007507	0.890	heart development
GO:0048522	0.884	positive regulation of cellular process
GO:0009968	0.884	negative regulation of signal transduction
GO:0009893	0.866	positive regulation of metabolic process
GO:0019220	0.861	regulation of phosphate metabolic process
GO:0010604	0.861	positive regulation of macromolecule metabolic process
GO:0051173	0.857	positive regulation of nitrogen compound metabolic process
GO:0006355	0.856	regulation of DNA-templated transcription
GO:0007165	0.855	signal transduction
GO:0009653	0.853	anatomical structure morphogenesis
GO:0009719	0.849	response to endogenous stimulus
GO:0007166	0.807	cell surface receptor signaling pathway
GO:0090092	0.806	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0071363	0.800	cellular response to growth factor stimulus
GO:0010605	0.792	negative regulation of macromolecule metabolic process
GO:0045595	0.787	regulation of cell differentiation
GO:0031325	0.779	positive regulation of cellular metabolic process
GO:0007167	0.760	enzyme-linked receptor protein signaling pathway
GO:0042221	0.753	response to chemical
GO:0007178	0.740	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0051172	0.716	negative regulation of nitrogen compound metabolic process
GO:0051246	0.692	regulation of protein metabolic process
GO:0010033	0.691	response to organic substance
GO:0009725	0.673	response to hormone
GO:0042127	0.667	regulation of cell population proliferation
GO:0030154	0.661	cell differentiation
GO:0031399	0.653	regulation of protein modification process
GO:0003170	0.653	heart valve development
GO:1905314	0.628	semi-lunar valve development
GO:0045935	0.600	positive regulation of nucleobase-containing compound metabolic process
GO:0051093	0.599	negative regulation of developmental process
GO:0009891	0.586	positive regulation of biosynthetic process
GO:0001932	0.576	regulation of protein phosphorylation
GO:0031328	0.566	positive regulation of cellular biosynthetic process
GO:0010557	0.560	positive regulation of macromolecule biosynthetic process
GO:0008152	0.518	metabolic process
GO:0051254	0.505	positive regulation of RNA metabolic process
GO:0045893	0.479	positive regulation of DNA-templated transcription
GO:0045936	0.455	negative regulation of phosphate metabolic process
GO:0051240	0.444	positive regulation of multicellular organismal process
GO:0006357	0.414	regulation of transcription by RNA polymerase II
GO:0065009	0.400	regulation of molecular function
GO:0051094	0.392	positive regulation of developmental process
GO:0031327	0.382	negative regulation of cellular biosynthetic process
GO:0044237	0.381	cellular metabolic process
GO:0010558	0.381	negative regulation of macromolecule biosynthetic process
GO:0051253	0.375	negative regulation of RNA metabolic process
GO:0060393	0.370	regulation of pathway-restricted SMAD protein phosphorylation
GO:0045892	0.368	negative regulation of DNA-templated transcription
GO:0051241	0.363	negative regulation of multicellular organismal process
GO:0090287	0.350	regulation of cellular response to growth factor stimulus
GO:0008285	0.344	negative regulation of cell population proliferation
GO:0051128	0.332	regulation of cellular component organization
GO:0006950	0.331	response to stress
GO:0010941	0.327	regulation of cell death
GO:0009888	0.316	tissue development
GO:2000026	0.315	regulation of multicellular organismal development
GO:0045944	0.300	positive regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	0.998	nucleoplasm
GO:0012505	0.997	endomembrane system
GO:0032991	0.992	protein-containing complex
GO:0005829	0.986	cytosol
GO:0016604	0.536	nuclear body
GO:0031982	0.464	vesicle
GO:0005794	0.462	Golgi apparatus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]