StarFunc result for job id O43542

User Input

>input (346 residues)
MDLDLLDLNPRIIAAIKKAKLKSVKEVLHFSGPDLKRLTNLSSPEVWHLLRTASLHLRGS
SILTALQLHQQKERFPTQHQRLSLGCPVLDALLRGGLPLDGITELAGRSSAGKTQLALQL
CLAVQFPRQHGGLEAGAVYICTEDAFPHKRLQQLMAQQPRLRTDVPGELLQKLRFGSQIF
IEHVADVDTLLECVNKKVPVLLSRGMARLVVIDSVAAPFRCEFDSQASAPRARHLQSLGA
TLRELSSAFQSPVLCINQVTEAMEEQGAAHGPLGFWDERVSPALGITWANQLLVRLLADR
LREEEAALGCPARTLRVLSAPHLPPSSCSYTISAEGVRGTPGTQSH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43542	1.000	1.000	1.294E-71	346	1.000	1.000	O43542.pdb.gz	XRCC3_HUMAN DNA repair protein XRCC3 OS=Homo sapiens OX=9606 GN=XRCC3 PE=1 SV=1
2	AFDB:D4A5N4	0.955	0.947	1.366E-54	349	0.734	0.728	D4A5N4.pdb.gz	D4A5N4_RAT DNA repair protein OS=Rattus norvegicus OX=10116 GN=Xrcc3 PE=3 SV=2
3	AFDB:O77135	0.758	0.769	5.255E-29	341	0.312	0.317	O77135.pdb.gz	O77135_DROME FI03211p OS=Drosophila melanogaster OX=7227 GN=spn-B PE=2 SV=1
4	AFDB:Q9UUL2	0.761	0.745	6.313E-28	354	0.263	0.257	Q9UUL2.pdb.gz	RAD57_SCHPO DNA repair protein rhp57 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rhp57 PE=1 SV=1
5	AFDB:J9PFC8	0.661	0.656	7.509E-28	349	0.266	0.264	J9PFC8.pdb.gz	J9PFC8_ORYSA RAD51C-1 OS=Oryza sativa OX=4530 GN=RAD51C PE=4 SV=1
6	AFDB:O15315	0.754	0.688	3.790E-27	384	0.275	0.247	O15315.pdb.gz	RA51B_HUMAN DNA repair protein RAD51 homolog 2 OS=Homo sapiens OX=9606 GN=RAD51B PE=1 SV=2
7	AFDB:F4IW45	0.642	0.579	2.867E-26	387	0.266	0.238	F4IW45.pdb.gz	F4IW45_ARATH RAS associated with diabetes protein 51C OS=Arabidopsis thaliana OX=3702 GN=RAD51C PE=4 SV=1
8	AFDB:O35719	0.741	0.733	6.440E-26	350	0.269	0.266	O35719.pdb.gz	RA51B_MOUSE DNA repair protein RAD51 homolog 2 OS=Mus musculus OX=10090 GN=Rad51b PE=2 SV=2
9	AFDB:Q9SK02	0.760	0.716	1.721E-25	370	0.214	0.200	Q9SK02.pdb.gz	RA51B_ARATH DNA repair protein RAD51 homolog 2 OS=Arabidopsis thaliana OX=3702 GN=RAD51B PE=2 SV=2
10	AFDB:Q8R2J9	0.685	0.650	3.068E-25	366	0.269	0.254	Q8R2J9.pdb.gz	RA51C_CRIGR DNA repair protein RAD51 homolog 3 OS=Cricetulus griseus OX=10029 GN=RAD51C PE=2 SV=1
11	PDB:7ej6B	0.709	0.768	1.380E-21	316	0.243	0.266	7ej6B.pdb.gz	Mechanisms of distinctive mismatch tolerance between Rad51 and Dmc1 in homologous recombination.
12	PDB:7c98A	0.723	0.801	7.380E-21	309	0.211	0.236	7c98A.pdb.gz	Identification of fidelity-governing factors in human recombinases DMC1 and RAD51 from cryo-EM structures.
13	PDB:1xu4A	0.685	0.738	2.956E-20	318	0.217	0.236	1xu4A.pdb.gz	Crystal structure of an ATPase-active form of Rad51 homolog from Methanococcus voltae. Insights into potassium dependence
14	PDB:3ldaA	0.642	0.743	2.510E-19	293	0.240	0.283	3ldaA.pdb.gz
15	PDB:3fyhA	0.628	0.722	1.208E-17	296	0.208	0.243	3fyhA.pdb.gz	Crystal structure of an archaeal Rad51 homologue in complex with a metatungstate inhibitor.
16	PDB:5jzcA	0.671	0.735	7.680E-17	312	0.234	0.260	5jzcA.pdb.gz
17	PDB:3cmtD	0.539	0.131	1.131E-12	1609	0.182	0.039	3cmtD.pdb.gz	Mechanism of homologous recombination from the RecA-ssDNA/dsDNA structures.
18	PDB:4esvC	0.514	0.426	9.601E-12	434	0.162	0.129	4esvC.pdb.gz	The Hexameric Helicase DnaB Adopts a Nonplanar Conformation during Translocation.
19	PDB:3cmuA	0.519	0.107	3.051E-11	1937	0.179	0.032	3cmuA.pdb.gz	Mechanism of homologous recombination from the RecA-ssDNA/dsDNA structures.
20	PDB:3cmvA	0.477	0.159	8.153E-11	1190	0.188	0.055	3cmvA.pdb.gz	Mechanism of homologous recombination from the RecA-ssDNA/dsDNA structures.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43542	0.0	697	346	1.000	1.000	XRCC3_HUMAN DNA repair protein XRCC3 OS=Homo sapiens OX=9606 GN=XRCC3 PE=1 SV=1
2	Q53XC8	0.0	697	346	1.000	1.000	Q53XC8_HUMAN Full-length cDNA clone CS0DC014YE11 of Neuroblastoma of Homo sapiens (human) OS=Homo sapiens OX=9606 GN=XRCC3 PE=2 SV=1
3	D4A5N4	3.78e-173	486	345	0.737	0.739	D4A5N4_RAT DNA repair protein OS=Rattus norvegicus OX=10116 GN=Xrcc3 PE=3 SV=2
4	G3V3Q2	8.69e-98	287	141	0.408	1.000	G3V3Q2_HUMAN X-ray repair cross complementing 3 OS=Homo sapiens OX=9606 GN=XRCC3 PE=1 SV=1
5	Q9FKM5	5.62e-39	142	304	0.280	0.319	XRCC3_ARATH DNA repair protein XRCC3 homolog OS=Arabidopsis thaliana OX=3702 GN=XRCC3 PE=1 SV=1
6	O77135	3.32e-38	141	341	0.272	0.276	O77135_DROME FI03211p OS=Drosophila melanogaster OX=7227 GN=spn-B PE=2 SV=1
7	Q8SZF1	1.12e-37	139	341	0.269	0.273	Q8SZF1_DROME RE02671p OS=Drosophila melanogaster OX=7227 GN=spn-B PE=2 SV=1
8	Q9UUL2	5.16e-31	122	354	0.272	0.266	RAD57_SCHPO DNA repair protein rhp57 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rhp57 PE=1 SV=1
9	J9PFC8	2.25e-24	103	349	0.240	0.238	J9PFC8_ORYSA RAD51C-1 OS=Oryza sativa OX=4530 GN=RAD51C PE=4 SV=1
10	P94102	3.45e-24	103	342	0.263	0.266	RAD51_ARATH DNA repair protein RAD51 homolog 1 OS=Arabidopsis thaliana OX=3702 GN=RAD51 PE=1 SV=1
11	O42634	6.18e-24	102	332	0.246	0.256	DMC1_SCHPO Meiotic recombination protein dmc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dmc1 PE=1 SV=2
12	O15315	6.53e-22	97.4	384	0.234	0.211	RA51B_HUMAN DNA repair protein RAD51 homolog 2 OS=Homo sapiens OX=9606 GN=RAD51B PE=1 SV=2
13	P25453	1.01e-21	96.3	334	0.257	0.266	DMC1_YEAST Meiotic recombination protein DMC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DMC1 PE=1 SV=1
14	O35719	4.96e-20	91.7	350	0.269	0.266	RA51B_MOUSE DNA repair protein RAD51 homolog 2 OS=Mus musculus OX=10090 GN=Rad51b PE=2 SV=2
15	P25301	6.66e-20	92.4	460	0.205	0.154	RAD57_YEAST DNA repair protein RAD57 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAD57 PE=1 SV=1
16	F4IW45	7.03e-19	89.0	387	0.228	0.204	F4IW45_ARATH RAS associated with diabetes protein 51C OS=Arabidopsis thaliana OX=3702 GN=RAD51C PE=4 SV=1
17	O43502	8.24e-19	88.6	376	0.275	0.253	RA51C_HUMAN DNA repair protein RAD51 homolog 3 OS=Homo sapiens OX=9606 GN=RAD51C PE=1 SV=1
18	A0A1D8PFE4	9.72e-19	87.8	324	0.243	0.259	A0A1D8PFE4_CANAL Recombinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DLH1 PE=3 SV=1
19	Q8R2J9	1.06e-18	88.2	366	0.272	0.257	RA51C_CRIGR DNA repair protein RAD51 homolog 3 OS=Cricetulus griseus OX=10029 GN=RAD51C PE=2 SV=1
20	Q39009	1.35e-18	87.4	344	0.214	0.215	DMC1_ARATH Meiotic recombination protein DMC1 homolog OS=Arabidopsis thaliana OX=3702 GN=DMC1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13481 AAA_25	2.9e-05	35.2	AAA domain
2	PF06745 ATPase	2.8	18.8	KaiC
3	PF03796 DnaB_C	0.97	20.3	DnaB-like helicase C terminal domain
4	PF08423 Rad51	3.3e-36	136.4	Rad51
5	PF00154 RecA	0.36	21.8	recA bacterial DNA recombination protein
6	PF03118 RNA_pol_A_CTD	1.3e+02	13.8	Bacterial RNA polymerase, alpha chain C terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000451974

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000352271	0.998	DNA repair protein XRCC2
2	9606.ENSP00000369497	0.998	Breast cancer type 2 susceptibility protein
3	9606.ENSP00000466834	0.998	annotation not available
4	9606.ENSP00000367910	0.997	Fanconi anemia group G protein
5	9606.ENSP00000336701	0.994	DNA repair protein RAD51 homolog 3
6	9606.ENSP00000347232	0.992	Bloom syndrome protein
7	9606.ENSP00000372088	0.989	DNA repair protein RAD51 homolog 1
8	9606.ENSP00000307853	0.987	Crossover junction endonuclease MUS81
9	9606.ENSP00000318977	0.987	Flap endonuclease GEN homolog 1
10	9606.ENSP00000287647	0.984	Fanconi anemia group D2 protein
11	9606.ENSP00000351284	0.980	DNA repair protein RAD52 homolog
12	9606.ENSP00000466399	0.980	Uncharacterized protein
13	9606.ENSP00000298139	0.975	Werner syndrome ATP-dependent helicase
14	9606.ENSP00000419471	0.973	DNA repair protein RAD51 homolog 2
15	9606.ENSP00000254719	0.969	Replication protein A 70 kDa DNA-binding subunit
16	9606.ENSP00000376952	0.965	Crossover junction endonuclease EME1
17	9606.ENSP00000406046	0.965	DNA polymerase delta catalytic subunit
18	9606.ENSP00000361310	0.963	DNA polymerase eta
19	9606.ENSP00000322570	0.959	DNA polymerase epsilon catalytic subunit A
20	9606.ENSP00000055077	0.956	Replication factor C subunit 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004520	0.998	DNA endonuclease activity
GO:0000217	0.997	DNA secondary structure binding
GO:0000400	0.994	four-way junction DNA binding
GO:0008821	0.991	crossover junction DNA endonuclease activity
GO:0003697	0.643	single-stranded DNA binding
GO:0003690	0.452	double-stranded DNA binding
GO:0008094	0.368	ATP-dependent activity, acting on DNA

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.997	response to stimulus
GO:0044238	0.995	primary metabolic process
GO:0006807	0.995	nitrogen compound metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0043170	0.995	macromolecule metabolic process
GO:0051716	0.993	cellular response to stimulus
GO:0006950	0.990	response to stress
GO:0006310	0.986	DNA recombination
GO:0006974	0.981	cellular response to DNA damage stimulus
GO:0050794	0.976	regulation of cellular process
GO:0006996	0.960	organelle organization
GO:0006281	0.949	DNA repair
GO:0051276	0.947	chromosome organization
GO:0006302	0.862	double-strand break repair
GO:1901987	0.823	regulation of cell cycle phase transition
GO:0033044	0.814	regulation of chromosome organization
GO:0032200	0.785	telomere organization
GO:0048518	0.672	positive regulation of biological process
GO:0048522	0.607	positive regulation of cellular process
GO:0051983	0.584	regulation of chromosome segregation
GO:0033045	0.566	regulation of sister chromatid segregation
GO:0007346	0.554	regulation of mitotic cell cycle
GO:0000724	0.543	double-strand break repair via homologous recombination
GO:1905818	0.521	regulation of chromosome separation
GO:1902099	0.499	regulation of metaphase/anaphase transition of cell cycle
GO:0010965	0.492	regulation of mitotic sister chromatid separation
GO:0048583	0.405	regulation of response to stimulus
GO:0000723	0.394	telomere maintenance
GO:1901990	0.325	regulation of mitotic cell cycle phase transition
GO:0033047	0.308	regulation of mitotic sister chromatid segregation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005654	0.999	nucleoplasm
GO:0005829	0.991	cytosol
GO:0043232	0.986	intracellular non-membrane-bounded organelle
GO:0032991	0.966	protein-containing complex
GO:0005694	0.913	chromosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.-.-	0.999	Acting on ester bonds.
EC:3.1.21.10	0.991	crossover junction endodeoxyribonuclease.

[back to server]