StarFunc result for job id O43557

User Input

>input (240 residues)
MEESVVRPSVFVVDGQTDIPFTRLGRSHRRQSCSVARVGLGLLLLLMGAGLAVQGWFLLQ
LHWRLGEMVTRLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGL
AFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELL
VSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43557	1.000	1.000	1.816E-42	240	1.000	1.000	O43557.pdb.gz	TNF14_HUMAN Tumor necrosis factor ligand superfamily member 14 OS=Homo sapiens OX=9606 GN=TNFSF14 PE=1 SV=2
2	AFDB:Q9QYH9	0.615	0.618	4.618E-29	239	0.767	0.770	Q9QYH9.pdb.gz	TNF14_MOUSE Tumor necrosis factor ligand superfamily member 14 OS=Mus musculus OX=10090 GN=Tnfsf14 PE=2 SV=1
3	AFDB:P41047	0.576	0.499	5.361E-17	279	0.267	0.229	P41047.pdb.gz	TNFL6_MOUSE Tumor necrosis factor ligand superfamily member 6 OS=Mus musculus OX=10090 GN=Faslg PE=1 SV=1
4	AFDB:P48023	0.602	0.527	3.274E-16	281	0.246	0.210	P48023.pdb.gz	TNFL6_HUMAN Tumor necrosis factor ligand superfamily member 6 OS=Homo sapiens OX=9606 GN=FASLG PE=1 SV=1
5	AFDB:Q0PKX7	0.594	0.544	4.752E-16	268	0.242	0.216	Q0PKX7.pdb.gz	Q0PKX7_DANRE Fas ligand OS=Danio rerio OX=7955 GN=fasl PE=2 SV=1
6	AFDB:Q8K3Y7	0.557	0.531	1.174E-15	252	0.271	0.258	Q8K3Y7.pdb.gz	TNF15_RAT Tumor necrosis factor ligand superfamily member 15 OS=Rattus norvegicus OX=10116 GN=Tnfsf15 PE=2 SV=1
7	AFDB:O95150	0.554	0.530	1.377E-15	251	0.267	0.255	O95150.pdb.gz	TNF15_HUMAN Tumor necrosis factor ligand superfamily member 15 OS=Homo sapiens OX=9606 GN=TNFSF15 PE=1 SV=2
8	AFDB:Q08CQ3	0.576	0.590	1.221E-14	234	0.229	0.235	Q08CQ3.pdb.gz	Q08CQ3_DANRE Lymphotoxin-alpha OS=Danio rerio OX=7955 GN=tnfa PE=2 SV=1
9	AFDB:P01375	0.561	0.576	2.572E-14	233	0.242	0.249	P01375.pdb.gz	TNFA_HUMAN Tumor necrosis factor OS=Homo sapiens OX=9606 GN=TNF PE=1 SV=1
10	AFDB:P50592	0.539	0.449	2.861E-14	291	0.246	0.203	P50592.pdb.gz	TNF10_MOUSE Tumor necrosis factor ligand superfamily member 10 OS=Mus musculus OX=10090 GN=Tnfsf10 PE=2 SV=1
11	PDB:5h4bA	0.419	0.692	8.420E-6	136	0.083	0.147	5h4bA.pdb.gz
12	PDB:7e57B	0.375	0.685	2.574E-5	123	0.087	0.171	7e57B.pdb.gz	Atypical TNF-TNFR superfamily binding interface in the GITR-GITRL complex for T cell activation.
13	PDB:5kc6B	0.419	0.654	6.710E-5	144	0.075	0.125	5kc6B.pdb.gz
14	PDB:7drtB	0.228	0.138	8.975E-3	496	0.067	0.032	7drtB.pdb.gz	Cryo-EM structure of human Wntless in complex with Wnt3a.
15	PDB:6oj0A	0.221	0.274	1.303E-2	178	0.092	0.124	6oj0A.pdb.gz
16	PDB:4tlgA	0.196	0.128	1.793E-2	396	0.054	0.033	4tlgA.pdb.gz	Crystal structure of SEC14-like protein 4 (SEC14L4)
17	PDB:3b2dC	0.175	0.251	1.994E-2	139	0.062	0.108	3b2dC.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
18	PDB:5vqfB	0.268	0.218	1.994E-2	320	0.083	0.062	5vqfB.pdb.gz
19	PDB:3zmoA	0.214	0.268	2.218E-2	172	0.129	0.180	3zmoA.pdb.gz
20	PDB:5ntuA	0.250	0.210	2.467E-2	308	0.075	0.058	5ntuA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43557	1.03e-174	481	240	1.000	1.000	TNF14_HUMAN Tumor necrosis factor ligand superfamily member 14 OS=Homo sapiens OX=9606 GN=TNFSF14 PE=1 SV=2
2	Q9QYH9	2.30e-119	341	239	0.754	0.757	TNF14_MOUSE Tumor necrosis factor ligand superfamily member 14 OS=Mus musculus OX=10090 GN=Tnfsf14 PE=2 SV=1
3	P41047	1.96e-17	81.3	279	0.246	0.211	TNFL6_MOUSE Tumor necrosis factor ligand superfamily member 6 OS=Mus musculus OX=10090 GN=Faslg PE=1 SV=1
4	P48023	2.60e-17	80.9	281	0.254	0.217	TNFL6_HUMAN Tumor necrosis factor ligand superfamily member 6 OS=Homo sapiens OX=9606 GN=FASLG PE=1 SV=1
5	Q53ZZ1	2.60e-17	80.9	281	0.254	0.217	Q53ZZ1_HUMAN Tumor necrosis factor ligand superfamily member 6 OS=Homo sapiens OX=9606 GN=TNFSF6 PE=2 SV=1
6	Q0VHD7	5.64e-17	80.1	281	0.254	0.217	Q0VHD7_HUMAN Tumor necrosis factor ligand superfamily member 6 OS=Homo sapiens OX=9606 GN=FASLG PE=2 SV=1
7	O95150	1.43e-16	78.6	251	0.263	0.251	TNF15_HUMAN Tumor necrosis factor ligand superfamily member 15 OS=Homo sapiens OX=9606 GN=TNFSF15 PE=1 SV=2
8	P36940	4.67e-16	77.4	278	0.183	0.158	TNFL6_RAT Tumor necrosis factor ligand superfamily member 6 OS=Rattus norvegicus OX=10116 GN=Faslg PE=2 SV=1
9	Q8K3Y7	9.25e-16	76.3	252	0.204	0.194	TNF15_RAT Tumor necrosis factor ligand superfamily member 15 OS=Rattus norvegicus OX=10116 GN=Tnfsf15 PE=2 SV=1
10	C1K3N5	2.06e-13	69.3	232	0.196	0.203	C1K3N5_HUMAN Tumor necrosis factor (Fragment) OS=Homo sapiens OX=9606 GN=TNF PE=2 SV=1
11	P01375	2.20e-13	69.3	233	0.196	0.202	TNFA_HUMAN Tumor necrosis factor OS=Homo sapiens OX=9606 GN=TNF PE=1 SV=1
12	B3GDZ6	4.07e-13	68.6	232	0.233	0.241	B3GDZ6_PIG Tumor necrosis factor OS=Sus scrofa OX=9823 GN=TNFa PE=2 SV=1
13	P23563	4.07e-13	68.6	232	0.233	0.241	TNFA_PIG Tumor necrosis factor OS=Sus scrofa OX=9823 GN=TNF PE=2 SV=1
14	P06804	5.89e-13	68.2	235	0.192	0.196	TNFA_MOUSE Tumor necrosis factor OS=Mus musculus OX=10090 GN=Tnf PE=1 SV=2
15	P16599	1.28e-12	67.4	235	0.188	0.191	TNFA_RAT Tumor necrosis factor OS=Rattus norvegicus OX=10116 GN=Tnf PE=2 SV=1
16	Q06599	1.85e-11	63.9	234	0.192	0.197	TNFA_BOVIN Tumor necrosis factor OS=Bos taurus OX=9913 GN=TNF PE=2 SV=2
17	P50591	9.69e-11	62.4	281	0.221	0.189	TNF10_HUMAN Tumor necrosis factor ligand superfamily member 10 OS=Homo sapiens OX=9606 GN=TNFSF10 PE=1 SV=1
18	Q0PKX7	1.73e-09	58.9	268	0.225	0.201	Q0PKX7_DANRE Fas ligand OS=Danio rerio OX=7955 GN=fasl PE=2 SV=1
19	Q06643	8.89e-09	56.6	244	0.237	0.234	TNFC_HUMAN Lymphotoxin-beta OS=Homo sapiens OX=9606 GN=LTB PE=1 SV=1
20	P50592	1.47e-08	56.2	291	0.200	0.165	TNF10_MOUSE Tumor necrosis factor ligand superfamily member 10 OS=Mus musculus OX=10090 GN=Tnfsf10 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00229 TNF	2.9e-28	109.8	TNF(Tumour Necrosis Factor) family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000469049

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000347948	0.999	Tumor necrosis factor receptor superfamily member 14
2	9606.ENSP00000228918	0.998	Tumor necrosis factor receptor superfamily member 3
3	9606.ENSP00000359013	0.997	Tumor necrosis factor receptor superfamily, member 6b, decoy
4	9606.ENSP00000480348	0.915	annotation not available
5	9606.ENSP00000359663	0.771	CD40 ligand
6	9606.ENSP00000454207	0.765	TNF receptor-associated factor 3
7	9606.ENSP00000465500	0.762	Tumor necrosis factor receptor superfamily member 11A
8	9606.ENSP00000365048	0.761	Tumor necrosis factor ligand superfamily member 13B
9	9606.ENSP00000381775	0.751	Tumor necrosis factor ligand superfamily member 11
10	9606.ENSP00000361359	0.748	Tumor necrosis factor receptor superfamily member 5
11	9606.ENSP00000293825	0.746	Tumor necrosis factor ligand superfamily member 12
12	9606.ENSP00000410481	0.732	Lymphotoxin-beta
13	9606.ENSP00000477613	0.731	Baculoviral IAP repeat-containing protein 2
14	9606.ENSP00000333919	0.730	B- and T-lymphocyte attenuator
15	9606.ENSP00000247668	0.716	TNF receptor-associated factor 2
16	9606.ENSP00000403495	0.712	Lymphotoxin-alpha
17	9606.ENSP00000365435	0.707	Tumor necrosis factor receptor superfamily member 1B
18	9606.ENSP00000326737	0.702	Tumor necrosis factor receptor superfamily member 12A
19	9606.ENSP00000398698	0.688	Tumor necrosis factor
20	9606.ENSP00000291232	0.675	Tumor necrosis factor receptor superfamily member 13C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	0.999	signaling receptor binding
GO:0098772	0.984	molecular function regulator activity
GO:0042802	0.851	identical protein binding
GO:0030234	0.594	enzyme regulator activity
GO:0140677	0.516	molecular function activator activity
GO:0005126	0.501	cytokine receptor binding
GO:0043028	0.440	cysteine-type endopeptidase regulator activity involved in apoptotic process
GO:0043027	0.433	cysteine-type endopeptidase inhibitor activity involved in apoptotic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.997	response to stimulus
GO:0009987	0.997	cellular process
GO:0050794	0.997	regulation of cellular process
GO:0048518	0.995	positive regulation of biological process
GO:0002682	0.991	regulation of immune system process
GO:0051716	0.989	cellular response to stimulus
GO:0048522	0.989	positive regulation of cellular process
GO:0051239	0.988	regulation of multicellular organismal process
GO:0007154	0.984	cell communication
GO:0048583	0.983	regulation of response to stimulus
GO:0010646	0.983	regulation of cell communication
GO:0023052	0.972	signaling
GO:0048584	0.961	positive regulation of response to stimulus
GO:0009966	0.961	regulation of signal transduction
GO:0007165	0.961	signal transduction
GO:1903039	0.959	positive regulation of leukocyte cell-cell adhesion
GO:0002684	0.956	positive regulation of immune system process
GO:0050870	0.950	positive regulation of T cell activation
GO:0023056	0.941	positive regulation of signaling
GO:0002376	0.933	immune system process
GO:0009605	0.920	response to external stimulus
GO:0010647	0.877	positive regulation of cell communication
GO:0009967	0.871	positive regulation of signal transduction
GO:1902531	0.830	regulation of intracellular signal transduction
GO:0051094	0.824	positive regulation of developmental process
GO:0042221	0.671	response to chemical
GO:1902533	0.667	positive regulation of intracellular signal transduction
GO:0070887	0.634	cellular response to chemical stimulus
GO:0019222	0.577	regulation of metabolic process
GO:0060255	0.560	regulation of macromolecule metabolic process
GO:0016477	0.532	cell migration
GO:0006915	0.458	apoptotic process
GO:0050900	0.423	leukocyte migration
GO:0010604	0.423	positive regulation of macromolecule metabolic process
GO:2000145	0.407	regulation of cell motility
GO:0010468	0.388	regulation of gene expression
GO:0030334	0.381	regulation of cell migration
GO:0010033	0.372	response to organic substance
GO:0032501	0.371	multicellular organismal process
GO:0043067	0.355	regulation of programmed cell death
GO:0042981	0.352	regulation of apoptotic process
GO:0002685	0.344	regulation of leukocyte migration
GO:0060326	0.332	cell chemotaxis
GO:0080090	0.324	regulation of primary metabolic process
GO:0045595	0.324	regulation of cell differentiation
GO:0051171	0.321	regulation of nitrogen compound metabolic process
GO:0071674	0.321	mononuclear cell migration
GO:0032502	0.312	developmental process
GO:0048856	0.304	anatomical structure development
GO:0031295	0.301	T cell costimulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]