StarFunc result for job id O43559

User Input

>input (492 residues)
MGSCCSCLNRDSVPDNHPTKFKVTNVDDEGVELGSGVMELTQSELVLHLHRREAVRWPYL
CLRRYGYDSNLFSFESGRRCQTGQGIFAFKCSRAEEIFNLLQDLMQCNSINVMEEPVIIT
RNSHPAELDLPRAPQPPNALGYTVSSFSNGCPGEGPRFSAPRRLSTSSLRHPSLGEESTH
ALIAPDEQSHTYVNTPASEDDHRRGRHCLQPLPEGQAPFLPQARGPDQRDPQVFLQPGQV
KFVLGPTPARRHMVKCQGLCPSLHDPPHHNNNNEAPSECPAQPKCTYENVTGGLWRGAGW
RLSPEEPGWNGLAHRRAALLHYENLPPLPPVWESQAQQLGGEAGDDGDSRDGLTPSSNGF
PDGEEDETPLQKPTSTRAAIRSHGSFPVPLTRRRGSPRVFNFDFRRPGPEPPRQLNYIQV
ELKGWGGDRPKGPQNPSSPQAPMPTTHPARSSDSYAVIDLKKTVAMSNLQRALPRDDGTA
RKTRHNSTDLPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43559	0.999	0.999	1.623E-73	492	1.000	1.000	O43559.pdb.gz	FRS3_HUMAN Fibroblast growth factor receptor substrate 3 OS=Homo sapiens OX=9606 GN=FRS3 PE=1 SV=3
2	AFDB:Q52RG8	0.306	0.306	1.963E-61	492	0.880	0.880	Q52RG8.pdb.gz	FRS3_RAT Fibroblast growth factor receptor substrate 3 OS=Rattus norvegicus OX=10116 GN=Frs3 PE=2 SV=3
3	AFDB:A0A384NQ31	0.256	0.248	6.846E-35	512	0.494	0.475	A0A384NQ31.pdb.gz	A0A384NQ31_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=1 SV=1
4	AFDB:E7F4P8	0.171	0.080	2.469E-5	1099	0.167	0.075	E7F4P8.pdb.gz	E7F4P8_DANRE Insulin receptor substrate 1 OS=Danio rerio OX=7955 GN=irs1 PE=4 SV=1
5	AFDB:F1Q6T9	0.159	0.075	6.090E-5	1168	0.154	0.065	F1Q6T9.pdb.gz	F1Q6T9_DANRE Tyrosine-protein phosphatase non-receptor type OS=Danio rerio OX=7955 GN=ptpn21 PE=3 SV=2
6	AFDB:F6P2Z4	0.138	0.099	1.133E-4	695	0.191	0.135	F6P2Z4.pdb.gz
7	AFDB:Q9XTN2	0.164	0.087	1.420E-4	968	0.161	0.082	Q9XTN2.pdb.gz	IRS1_DROME Insulin receptor substrate 1 OS=Drosophila melanogaster OX=7227 GN=chico PE=1 SV=1
8	AFDB:Q62728	0.144	0.066	8.166E-4	1175	0.146	0.061	Q62728.pdb.gz	PTN21_RAT Tyrosine-protein phosphatase non-receptor type 21 OS=Rattus norvegicus OX=10116 GN=Ptpn21 PE=1 SV=1
9	AFDB:D3ZAL7	0.150	0.112	1.904E-3	693	0.175	0.124	D3ZAL7.pdb.gz	D3ZAL7_RAT GRB2-associated binding protein 1 OS=Rattus norvegicus OX=10116 GN=Gab1 PE=1 SV=3
10	AFDB:P49797	0.143	0.078	3.747E-3	967	0.148	0.075	P49797.pdb.gz	RGS3_RAT Regulator of G-protein signaling 3 OS=Rattus norvegicus OX=10116 GN=Rgs3 PE=1 SV=2
11	PDB:6r9tA	0.158	0.037	4.747E-3	2185	0.026	0.006	6r9tA.pdb.gz
12	PDB:5oqj1	0.133	0.133	7.888E-3	491	0.018	0.018	5oqj1.pdb.gz	Structures of transcription pre-initiation complex with TFIIH and Mediator.
13	PDB:6xtbE	0.132	0.256	8.346E-3	235	0.041	0.085	6xtbE.pdb.gz
14	PDB:5yqrA	0.151	0.270	1.738E-2	268	0.026	0.049	5yqrA.pdb.gz
15	PDB:7o4i1	0.145	0.137	1.839E-2	522	0.020	0.019	7o4i1.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
16	PDB:7mp5A	0.147	0.046	2.305E-2	1629	0.016	0.005	7mp5A.pdb.gz
17	PDB:7r03B	0.126	0.030	2.580E-2	2246	0.012	0.003	7r03B.pdb.gz
18	PDB:4gnkB	0.147	0.097	2.889E-2	769	0.022	0.014	4gnkB.pdb.gz	Full-length G alpha (q)-phospholipase C-beta 3 structure reveals interfaces of the C-terminal coiled-coil domain.
19	PDB:4rm8A	0.141	0.183	3.234E-2	368	0.018	0.024	4rm8A.pdb.gz
20	PDB:6bbpA	0.142	0.135	3.421E-2	520	0.026	0.025	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43559	0.0	1011	492	1.000	1.000	FRS3_HUMAN Fibroblast growth factor receptor substrate 3 OS=Homo sapiens OX=9606 GN=FRS3 PE=1 SV=3
2	Q52RG8	0.0	860	492	0.880	0.880	FRS3_RAT Fibroblast growth factor receptor substrate 3 OS=Rattus norvegicus OX=10116 GN=Frs3 PE=2 SV=3
3	Q8WU20	1.34e-137	408	508	0.498	0.482	FRS2_HUMAN Fibroblast growth factor receptor substrate 2 OS=Homo sapiens OX=9606 GN=FRS2 PE=1 SV=4
4	A0A384NQ31	1.96e-137	407	512	0.498	0.479	A0A384NQ31_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=1 SV=1
5	Q8C180	6.67e-136	404	508	0.496	0.480	FRS2_MOUSE Fibroblast growth factor receptor substrate 2 OS=Mus musculus OX=10090 GN=Frs2 PE=1 SV=3
6	D4A244	6.71e-135	401	508	0.498	0.482	D4A244_RAT Fibroblast growth factor receptor substrate 2 OS=Rattus norvegicus OX=10116 GN=Frs2 PE=1 SV=1
7	P97465	9.88e-11	66.2	482	0.085	0.087	DOK1_MOUSE Docking protein 1 OS=Mus musculus OX=10090 GN=Dok1 PE=1 SV=2
8	Q99704	5.84e-10	63.9	481	0.081	0.083	DOK1_HUMAN Docking protein 1 OS=Homo sapiens OX=9606 GN=DOK1 PE=1 SV=1
9	Q2MHE5	2.53e-09	60.8	331	0.059	0.088	DOK6_MOUSE Docking protein 6 OS=Mus musculus OX=10090 GN=Dok6 PE=1 SV=1
10	Q6PKX4	2.67e-09	60.8	331	0.059	0.088	DOK6_HUMAN Docking protein 6 OS=Homo sapiens OX=9606 GN=DOK6 PE=1 SV=1
11	Q9QZK7	6.62e-09	60.5	444	0.049	0.054	DOK3_MOUSE Docking protein 3 OS=Mus musculus OX=10090 GN=Dok3 PE=1 SV=1
12	O70469	1.49e-08	58.9	412	0.049	0.058	DOK2_MOUSE Docking protein 2 OS=Mus musculus OX=10090 GN=Dok2 PE=1 SV=1
13	Q9W3R6	4.45e-08	58.2	622	0.053	0.042	Q9W3R6_DROME Insulin receptor substrate 1 OS=Drosophila melanogaster OX=7227 GN=Dok PE=2 SV=1
14	O60496	4.52e-08	57.8	412	0.049	0.058	DOK2_HUMAN Docking protein 2 OS=Homo sapiens OX=9606 GN=DOK2 PE=1 SV=2
15	Q91ZM9	8.11e-08	56.2	306	0.045	0.072	DOK5_MOUSE Docking protein 5 OS=Mus musculus OX=10090 GN=Dok5 PE=1 SV=1
16	Q9P104	8.80e-08	56.2	306	0.045	0.072	DOK5_HUMAN Docking protein 5 OS=Homo sapiens OX=9606 GN=DOK5 PE=1 SV=2
17	Q99KE3	1.35e-07	55.8	325	0.051	0.077	DOK4_MOUSE Docking protein 4 OS=Mus musculus OX=10090 GN=Dok4 PE=1 SV=1
18	Q8TEW6	1.37e-07	55.8	326	0.051	0.077	DOK4_HUMAN Docking protein 4 OS=Homo sapiens OX=9606 GN=DOK4 PE=1 SV=2
19	A4IFJ7	1.38e-07	55.5	326	0.051	0.077	A4IFJ7_BOVIN DOK4 protein OS=Bos taurus OX=9913 GN=DOK4 PE=2 SV=1
20	Q7L591	3.86e-07	54.7	496	0.049	0.048	DOK3_HUMAN Docking protein 3 OS=Homo sapiens OX=9606 GN=DOK3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02174 IRS	2.2e-22	90.2	PTB domain (IRS-1 type)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362109

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000340944	0.992	Tyrosine-protein phosphatase non-receptor type 11
2	9606.ENSP00000376345	0.961	Growth factor receptor-bound protein 2
3	9606.ENSP00000401303	0.943	SHC-transforming protein 1
4	9606.ENSP00000393312	0.942	Fibroblast growth factor receptor 1
5	9606.ENSP00000431418	0.941	High affinity nerve growth factor receptor
6	9606.ENSP00000277120	0.933	BDNF/NT-3 growth factors receptor
7	9606.ENSP00000358525	0.919	Beta-nerve growth factor
8	9606.ENSP00000300574	0.916	Adapter molecule crk
9	9606.ENSP00000414303	0.916	Brain-derived neurotrophic factor
10	9606.ENSP00000346300	0.909	Crk-like protein
11	9606.ENSP00000361263	0.907	Rap guanine nucleotide exchange factor 1
12	9606.ENSP00000354952	0.905	GRB2-associated-binding protein 2
13	9606.ENSP00000447241	0.905	Fibroblast growth factor receptor substrate 2
14	9606.ENSP00000407586	0.904	GTPase HRas
15	9606.ENSP00000256078	0.903	GTPase KRas
16	9606.ENSP00000397297	0.903	Neurotrophin-3
17	9606.ENSP00000354207	0.901	NT-3 growth factor receptor
18	9606.ENSP00000250559	0.900	Ras-related protein Rap-1b
19	9606.ENSP00000358548	0.900	GTPase NRas
20	9606.ENSP00000358723	0.900	Ras-related protein Rap-1A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005104	0.995	fibroblast growth factor receptor binding
GO:0042802	0.968	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0051716	0.995	cellular response to stimulus
GO:0008543	0.990	fibroblast growth factor receptor signaling pathway
GO:0048518	0.611	positive regulation of biological process
GO:0048522	0.601	positive regulation of cellular process
GO:0032502	0.499	developmental process
GO:0048856	0.479	anatomical structure development
GO:0032501	0.380	multicellular organismal process
GO:0042127	0.337	regulation of cell population proliferation
GO:0008284	0.305	positive regulation of cell population proliferation
GO:0007275	0.301	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005737	0.789	cytoplasm
GO:0043231	0.431	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]