StarFunc result for job id O43561

User Input

>input (262 residues)
MEEAILVPCVLGLLLLPILAMLMALCVHCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPW
PPAYPPVTSYPPLSQPDLLPIPRSPQPLGGSHRTPSSRRDSDGANSVASYENEGASGIRG
AQAGWGVWGPSWTRLTPVSLPPEPACEDADEDEDDYHNPGYLVVLPDSTPATSTAAPSAP
ALSTPGIRDSAFSMESIDDYVNVPESGESAEASLDGSREYVNVSQELHPGAAKTEPAALS
SQEAEEVEEEGAPDYENLQELN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024QZD6	0.201	0.201	8.013E-34	262	1.000	1.000	A0A024QZD6.pdb.gz
2	AFDB:Q9SHQ9	0.084	0.075	2.859E-1	300	0.156	0.137	Q9SHQ9.pdb.gz	SPER4_ARATH Protein SPEAR4 OS=Arabidopsis thaliana OX=3702 GN=SPEAR4 PE=1 SV=1
3	AFDB:Q9Y5I2	0.115	0.037	3.072E-1	948	0.176	0.049	Q9Y5I2.pdb.gz	PCDAA_HUMAN Protocadherin alpha-10 OS=Homo sapiens OX=9606 GN=PCDHA10 PE=2 SV=1
4	AFDB:P48031	0.095	0.075	4.095E-1	348	0.164	0.124	P48031.pdb.gz	GBX2_MOUSE Homeobox protein GBX-2 OS=Mus musculus OX=10090 GN=Gbx2 PE=2 SV=1
5	AFDB:Q9NS68	0.133	0.087	7.276E-1	423	0.179	0.111	Q9NS68.pdb.gz	TNR19_HUMAN Tumor necrosis factor receptor superfamily member 19 OS=Homo sapiens OX=9606 GN=TNFRSF19 PE=1 SV=1
6	AFDB:Q9JLL3	0.133	0.089	7.818E-1	416	0.160	0.101	Q9JLL3.pdb.gz	TNR19_MOUSE Tumor necrosis factor receptor superfamily member 19 OS=Mus musculus OX=10090 GN=Tnfrsf19 PE=1 SV=2
7	AFDB:Q8AXK9	0.122	0.098	9.027E-1	342	0.134	0.102	Q8AXK9.pdb.gz
8	AFDB:Q9FKA5	0.092	0.088	1.389	381	0.168	0.115	Q9FKA5.pdb.gz	Y5957_ARATH Uncharacterized protein At5g39570 OS=Arabidopsis thaliana OX=3702 GN=At5g39570 PE=1 SV=1
9	AFDB:P40189	0.110	0.039	1.604	918	0.210	0.060	P40189.pdb.gz	IL6RB_HUMAN Interleukin-6 receptor subunit beta OS=Homo sapiens OX=9606 GN=IL6ST PE=1 SV=2
10	AFDB:P40190	0.106	0.033	1.990	918	0.210	0.060	P40190.pdb.gz	IL6RB_RAT Interleukin-6 receptor subunit beta OS=Rattus norvegicus OX=10116 GN=Il6st PE=1 SV=1
11	PDB:5mc6h	0.074	0.023	9.629	1121	0.050	0.012	5mc6h.pdb.gz	The cryo-EM structure of a ribosome-Ski2-Ski3-Ski8 helicase complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43561	0.0	525	262	1.000	1.000	LAT_HUMAN Linker for activation of T-cells family member 1 OS=Homo sapiens OX=9606 GN=LAT PE=1 SV=1
2	O54957	1.67e-77	236	242	0.565	0.612	LAT_MOUSE Linker for activation of T-cells family member 1 OS=Mus musculus OX=10090 GN=Lat PE=1 SV=1
3	Q90874	0.33	34.7	555	0.095	0.045	Q90874_CHICK IL-1 receptor I OS=Gallus gallus OX=9031 GN=IL-1 receptor I PE=2 SV=1
4	Q5KTT7	1.3	32.7	891	0.053	0.016	Q5KTT7_DANRE Eukaryotic translation initiation factor 4, gamma 2a OS=Danio rerio OX=7955 GN=NAT1A PE=1 SV=1
5	Q4LCS9	3.6	29.3	80	0.073	0.237	TXA22_ANDAU Beta-toxin KAaH2 OS=Androctonus australis OX=6858 PE=1 SV=1
6	Q9U3W7	5.4	30.8	809	0.053	0.017	Q9U3W7_DROME SP460 OS=Drosophila melanogaster OX=7227 GN=dpy PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15234 LAT	4.4e-118	404.8	Linker for activation of T-cells

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008959895.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003813338.1	0.997	Growth factor receptor bound protein 2
2	9597.XP_003825944.1	0.997	Phospholipase C gamma 1
3	9597.XP_008948775.1	0.995	Zeta-chain (TCR) associated protein kinase 70kDa
4	9597.XP_003810968.2	0.993	Lymphocyte cytosolic protein 2
5	9597.XP_003808402.1	0.986	Tyrosine-protein kinase SYK isoform X1
6	9597.XP_008973365.1	0.984	GRB2-related adapter protein 2 isoform X1
7	9597.XP_003820933.1	0.979	Phospholipase C gamma 2
8	9597.XP_003806841.1	0.959	Phosphoinositide-3-kinase regulatory subunit 1
9	9597.XP_008961579.1	0.942	FYN binding protein
10	9597.XP_008951754.1	0.924	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 147 ESTs, 18 Proteins, and 97% coverage of the annotated genomic feature by RNAseq alignments, including 4 samples with support for all annotated introns
11	9597.XP_008955633.1	0.923	Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha
12	9597.XP_008969294.1	0.923	Phosphatidylinositol 3-kinase regulatory subunit beta
13	9597.XP_003812802.2	0.897	Phosphoinositide-3-kinase regulatory subunit 3
14	9597.XP_003819441.1	0.897	Vav guanine nucleotide exchange factor 1
15	9597.XP_003826592.1	0.897	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform isoform X1
16	9597.XP_008973885.1	0.895	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform isoform X1
17	9597.XP_008956333.1	0.886	Tyrosine-protein phosphatase non-receptor type 11
18	9597.XP_003820043.1	0.884	E3 ubiquitin-protein ligase CBL
19	9597.XP_008971906.1	0.882	Tyrosine-protein phosphatase non-receptor type 6 isoform X1
20	9597.XP_008962502.1	0.858	CD244 molecule

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.890	enzyme binding
GO:0019901	0.735	protein kinase binding
GO:0060090	0.681	molecular adaptor activity
GO:0035591	0.621	signaling adaptor activity
GO:0030159	0.595	signaling receptor complex adaptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0051716	0.995	cellular response to stimulus
GO:0007165	0.993	signal transduction
GO:0002376	0.990	immune system process
GO:0002682	0.981	regulation of immune system process
GO:0007166	0.960	cell surface receptor signaling pathway
GO:0048518	0.955	positive regulation of biological process
GO:0048522	0.945	positive regulation of cellular process
GO:0050790	0.940	regulation of catalytic activity
GO:0019222	0.933	regulation of metabolic process
GO:0035556	0.920	intracellular signal transduction
GO:0032501	0.919	multicellular organismal process
GO:0031323	0.865	regulation of cellular metabolic process
GO:0080090	0.864	regulation of primary metabolic process
GO:0051338	0.843	regulation of transferase activity
GO:0001775	0.825	cell activation
GO:0009893	0.786	positive regulation of metabolic process
GO:0060255	0.773	regulation of macromolecule metabolic process
GO:0051171	0.764	regulation of nitrogen compound metabolic process
GO:0051239	0.729	regulation of multicellular organismal process
GO:0010604	0.727	positive regulation of macromolecule metabolic process
GO:0051174	0.716	regulation of phosphorus metabolic process
GO:0019220	0.707	regulation of phosphate metabolic process
GO:0048583	0.686	regulation of response to stimulus
GO:0042325	0.655	regulation of phosphorylation
GO:0031325	0.584	positive regulation of cellular metabolic process
GO:0051249	0.555	regulation of lymphocyte activation
GO:0031399	0.517	regulation of protein modification process
GO:0045321	0.479	leukocyte activation
GO:0051173	0.467	positive regulation of nitrogen compound metabolic process
GO:0001932	0.440	regulation of protein phosphorylation
GO:0044093	0.428	positive regulation of molecular function
GO:0045937	0.425	positive regulation of phosphate metabolic process
GO:0002764	0.418	immune response-regulating signaling pathway
GO:0048584	0.410	positive regulation of response to stimulus
GO:0042327	0.409	positive regulation of phosphorylation
GO:0050863	0.408	regulation of T cell activation
GO:0043085	0.405	positive regulation of catalytic activity
GO:0051247	0.405	positive regulation of protein metabolic process
GO:0043549	0.393	regulation of kinase activity
GO:0002768	0.386	immune response-regulating cell surface receptor signaling pathway
GO:0008152	0.380	metabolic process
GO:0001934	0.377	positive regulation of protein phosphorylation
GO:0046649	0.375	lymphocyte activation
GO:0002684	0.374	positive regulation of immune system process
GO:0045859	0.369	regulation of protein kinase activity
GO:0051347	0.355	positive regulation of transferase activity
GO:0033674	0.350	positive regulation of kinase activity
GO:0050778	0.346	positive regulation of immune response
GO:0071704	0.345	organic substance metabolic process
GO:0006955	0.329	immune response
GO:0002757	0.312	immune response-activating signaling pathway
GO:0002429	0.301	immune response-activating cell surface receptor signaling pathway
GO:0045860	0.301	positive regulation of protein kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0005794	0.997	Golgi apparatus
GO:0005829	0.780	cytosol
GO:0005634	0.587	nucleus
GO:0045121	0.499	membrane raft
GO:0070013	0.331	intracellular organelle lumen
GO:0001772	0.328	immunological synapse
GO:0032991	0.320	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]