StarFunc result for job id O43567

User Input

>input (381 residues)
MLLSIGMLMLSATQVYTILTVQLFAFLNLLPVEADILAYNFENASQTFDDLPARFGYRLP
AEGLKGFLINSKPENACEPIVPPPVKDNSSGTFIVLIRRLDCNFDIKVLNAQRAGYKAAI
VHNVDSDDLISMGSNDIEVLKKIDIPSVFIGESSANSLKDEFTYEKGGHLILVPEFSLPL
EYYLIPFLIIVGICLILIVIFMITKFVQDRHRARRNRLRKDQLKKLPVHKFKKGDEYDVC
AICLDEYEDGDKLRILPCSHAYHCKCVDPWLTKTKKTCPVCKQKVVPSQGDSDSDTDSSQ
EENEVTEHTPLLRPLASVSAQSFGALSESRSHQNMTESSDYEEDDNEDTDSSDAENEINE
HDVVVQLQPNGERDYNIANTV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43567	1.000	1.000	2.699E-73	381	1.000	1.000	O43567.pdb.gz	RNF13_HUMAN E3 ubiquitin-protein ligase RNF13 OS=Homo sapiens OX=9606 GN=RNF13 PE=1 SV=1
2	AFDB:Q9H6Y7	0.452	0.488	1.231E-42	350	0.420	0.457	Q9H6Y7.pdb.gz	RN167_HUMAN E3 ubiquitin-protein ligase RNF167 OS=Homo sapiens OX=9606 GN=RNF167 PE=1 SV=1
3	AFDB:Q9VI20	0.388	0.297	5.991E-33	536	0.341	0.243	Q9VI20.pdb.gz	GZL_DROME E3 ubiquitin-protein ligase Godzilla OS=Drosophila melanogaster OX=7227 GN=gzl PE=1 SV=1
4	AFDB:Q8WWF5	0.379	0.339	2.130E-28	429	0.318	0.282	Q8WWF5.pdb.gz	ZNRF4_HUMAN E3 ubiquitin-protein ligase ZNRF4 OS=Homo sapiens OX=9606 GN=ZNRF4 PE=1 SV=3
5	AFDB:Q8VZ14	0.378	0.328	1.375E-26	448	0.268	0.228	Q8VZ14.pdb.gz	RMR2_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 2 OS=Arabidopsis thaliana OX=3702 GN=RMR2 PE=2 SV=1
6	AFDB:C9J383	0.329	0.625	3.021E-24	192	0.486	0.964	C9J383.pdb.gz	C9J383_HUMAN RING-type E3 ubiquitin transferase (Fragment) OS=Homo sapiens OX=9606 GN=RNF13 PE=1 SV=1
7	AFDB:Q9M622	0.336	0.396	2.073E-22	310	0.265	0.326	Q9M622.pdb.gz	RMR1_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 1 OS=Arabidopsis thaliana OX=3702 GN=RMR1 PE=1 SV=1
8	AFDB:Q14B02	0.410	0.409	4.030E-20	382	0.218	0.217	Q14B02.pdb.gz	RN133_MOUSE E3 ubiquitin-protein ligase RNF133 OS=Mus musculus OX=10090 GN=Rnf133 PE=1 SV=1
9	AFDB:Q3U2C5	0.270	0.262	1.373E-19	394	0.228	0.221	Q3U2C5.pdb.gz	RN149_MOUSE E3 ubiquitin-protein ligase RNF149 OS=Mus musculus OX=10090 GN=Rnf149 PE=1 SV=3
10	AFDB:Q8NC42	0.281	0.269	1.865E-19	400	0.207	0.198	Q8NC42.pdb.gz	RN149_HUMAN E3 ubiquitin-protein ligase RNF149 OS=Homo sapiens OX=9606 GN=RNF149 PE=2 SV=2
11	PDB:7zqsB	0.244	0.151	1.651E-3	639	0.055	0.033	7zqsB.pdb.gz	Discovery of a Transferrin Receptor 1-Binding Aptamer and Its Application in Cancer Cell Depletion for Adoptive T-Cell Therapy Manufacturing.
12	PDB:7nvmD	0.163	0.125	1.247E-2	520	0.058	0.042	7nvmD.pdb.gz	Snapshots of actin and tubulin folding inside the TRiC chaperonin.
13	PDB:4tweA	0.196	0.113	1.499E-2	706	0.060	0.033	4tweA.pdb.gz	Structural and biochemical characterization of a novel aminopeptidase from human intestine.
14	PDB:6etyA	0.172	0.099	2.941E-2	696	0.058	0.032	6etyA.pdb.gz	Structural and computational basis for potent inhibition of glutamate carboxypeptidase II by carbamate-based inhibitors.
15	PDB:3fedA	0.139	0.081	3.995E-2	690	0.055	0.030	3fedA.pdb.gz	Structural insight into the evolutionary and pharmacologic homology of glutamate carboxypeptidases II and III
16	PDB:1jdbF	0.184	0.184	9.422E-2	380	0.050	0.050	1jdbF.pdb.gz	The structure of carbamoyl phosphate synthetase determined to 2.1 A resolution.
17	PDB:6ks6d	0.140	0.109	1.849E-1	524	0.060	0.044	6ks6d.pdb.gz	An ensemble of cryo-EM structures of TRiC reveal its conformational landscape and subunit specificity.
18	PDB:4cobA	0.148	0.230	2.512E-1	206	0.039	0.073	4cobA.pdb.gz	Structure of Bacterial Kynurenine Formamidase Reveals a Crowded Binuclear-Zinc Catalytic Site Primed to Generate a Potent Nucleophile.
19	PDB:5douD	0.193	0.065	3.857E-1	1430	0.052	0.014	5douD.pdb.gz	Structure of human carbamoyl phosphate synthetase: deciphering the on/off switch of human ureagenesis.
20	PDB:4cogA	0.154	0.246	8.555E-1	207	0.052	0.097	4cogA.pdb.gz	Structure of Bacterial Kynurenine Formamidase Reveals a Crowded Binuclear-Zinc Catalytic Site Primed to Generate a Potent Nucleophile.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43567	0.0	786	381	1.000	1.000	RNF13_HUMAN E3 ubiquitin-protein ligase RNF13 OS=Homo sapiens OX=9606 GN=RNF13 PE=1 SV=1
2	O54965	0.0	697	381	0.934	0.934	RNF13_MOUSE E3 ubiquitin-protein ligase RNF13 OS=Mus musculus OX=10090 GN=Rnf13 PE=1 SV=2
3	C9J383	1.40e-119	346	192	0.467	0.927	C9J383_HUMAN RING-type E3 ubiquitin transferase (Fragment) OS=Homo sapiens OX=9606 GN=RNF13 PE=1 SV=1
4	C9JYN7	4.22e-116	336	165	0.433	1.000	C9JYN7_HUMAN RING-type E3 ubiquitin transferase (Fragment) OS=Homo sapiens OX=9606 GN=RNF13 PE=1 SV=1
5	C9J8T4	2.47e-114	332	163	0.428	1.000	C9J8T4_HUMAN RING-type E3 ubiquitin transferase (Fragment) OS=Homo sapiens OX=9606 GN=RNF13 PE=1 SV=1
6	Q9H6Y7	6.44e-106	317	350	0.420	0.457	RN167_HUMAN E3 ubiquitin-protein ligase RNF167 OS=Homo sapiens OX=9606 GN=RNF167 PE=1 SV=1
7	C9JRV0	5.54e-78	237	115	0.302	1.000	C9JRV0_HUMAN RING-type E3 ubiquitin transferase (Fragment) OS=Homo sapiens OX=9606 GN=RNF13 PE=1 SV=1
8	Q8WWF5	3.23e-67	220	429	0.341	0.303	ZNRF4_HUMAN E3 ubiquitin-protein ligase ZNRF4 OS=Homo sapiens OX=9606 GN=ZNRF4 PE=1 SV=3
9	Q9VI20	3.11e-57	197	536	0.294	0.209	GZL_DROME E3 ubiquitin-protein ligase Godzilla OS=Drosophila melanogaster OX=7227 GN=gzl PE=1 SV=1
10	Q9M622	1.18e-37	139	310	0.228	0.281	RMR1_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 1 OS=Arabidopsis thaliana OX=3702 GN=RMR1 PE=1 SV=1
11	Q9DAH2	4.29e-34	130	327	0.244	0.284	ZNRF4_MOUSE E3 ubiquitin-protein ligase ZNRF4 OS=Mus musculus OX=10090 GN=Znrf4 PE=1 SV=1
12	Q8VZ14	8.08e-34	132	448	0.234	0.199	RMR2_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 2 OS=Arabidopsis thaliana OX=3702 GN=RMR2 PE=2 SV=1
13	Q9ULK6	1.44e-22	100	438	0.197	0.171	RN150_HUMAN RING finger protein 150 OS=Homo sapiens OX=9606 GN=RNF150 PE=1 SV=2
14	Q14B02	1.74e-21	97.1	382	0.194	0.194	RN133_MOUSE E3 ubiquitin-protein ligase RNF133 OS=Mus musculus OX=10090 GN=Rnf133 PE=1 SV=1
15	Q86XS8	2.85e-21	96.7	419	0.189	0.172	GOLI_HUMAN E3 ubiquitin-protein ligase RNF130 OS=Homo sapiens OX=9606 GN=RNF130 PE=1 SV=1
16	Q06003	5.81e-21	96.3	461	0.226	0.187	GOLI_DROME E3 ubiquitin-protein ligase goliath OS=Drosophila melanogaster OX=7227 GN=gol PE=1 SV=3
17	Q8VEM1	7.60e-21	95.5	419	0.184	0.167	GOLI_MOUSE E3 ubiquitin-protein ligase RNF130 OS=Mus musculus OX=10090 GN=Rnf130 PE=2 SV=1
18	Q3U2C5	2.56e-20	93.6	394	0.197	0.190	RN149_MOUSE E3 ubiquitin-protein ligase RNF149 OS=Mus musculus OX=10090 GN=Rnf149 PE=1 SV=3
19	Q8NC42	2.55e-18	87.8	400	0.205	0.195	RN149_HUMAN E3 ubiquitin-protein ligase RNF149 OS=Homo sapiens OX=9606 GN=RNF149 PE=2 SV=2
20	Q9D304	2.60e-18	88.2	428	0.215	0.192	RN128_MOUSE E3 ubiquitin-protein ligase RNF128 OS=Mus musculus OX=10090 GN=Rnf128 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03119 DNA_ligase_ZBD	3.5e+02	12.6	NAD-dependent DNA ligase C4 zinc finger domain
2	PF12669 FeoB_associated	2.3e+02	13.6	FeoB-associated Cys-rich membrane protein
3	PF06305 LapA_dom	4.7e+02	12.0	Lipopolysaccharide assembly protein A domain
4	PF02932 Neur_chan_memb	98	14.5	Neurotransmitter-gated ion-channel transmembrane region
5	PF04923 Ninjurin	9.2e+02	11.2	Ninjurin
6	PF02225 PA	1.1e-06	39.9	PA domain
7	PF00628 PHD	4.9e+02	12.0	PHD-finger
8	PF14447 Prok-RING_4	1.6	20.0	Prokaryotic RING finger family 4
9	PF12861 zf-ANAPC11	9.6	17.7	Anaphase-promoting complex subunit 11 RING-H2 finger
10	PF00097 zf-C3HC4	6.2e-05	34.1	Zinc finger, C3HC4 type (RING finger)
11	PF13923 zf-C3HC4_2	5.9e-05	34.1	Zinc finger, C3HC4 type (RING finger)
12	PF13920 zf-C3HC4_3	0.0078	27.3	Zinc finger, C3HC4 type (RING finger)
13	PF12678 zf-rbx1	0.041	25.5	RING-H2 zinc finger domain
14	PF17123 zf-RING_11	2e-08	45.1	RING-like zinc finger
15	PF17120 zf-RING_16	5.6e+02	11.6	RING/Ubox like zinc-binding domain
16	PF13639 zf-RING_2	1.4e-09	49.5	Ring finger domain
17	PF14570 zf-RING_4	7.6e+02	11.3	RING/Ubox like zinc-binding domain
18	PF14634 zf-RING_5	0.0045	28.2	zinc-RING finger domain
19	PF13445 zf-RING_UBOX	0.16	23.4	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000003850

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000017126	0.691	Tetratricopeptide repeat domain 26
2	61853.ENSNLEP00000018321	0.639	Adenosine deaminase, tRNA-specific 2
3	61853.ENSNLEP00000022739	0.630	Ribosomal protein S27a
4	61853.ENSNLEP00000022450	0.578	Uncharacterized protein
5	61853.ENSNLEP00000023098	0.578	Ubiquitin-conjugating enzyme E2D 3
6	61853.ENSNLEP00000010468	0.559	Leucine rich colipase-like 1
7	61853.ENSNLEP00000004574	0.557	Myosin, heavy chain 15
8	61853.ENSNLEP00000005789	0.547	Transcriptional repressor GATA binding 1
9	61853.ENSNLEP00000014947	0.515	Ubiquitin-conjugating enzyme E2D 1
10	61853.ENSNLEP00000008031	0.511	SH3 domain containing ring finger 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019900	1.000	kinase binding
GO:0004842	0.997	ubiquitin-protein transferase activity
GO:0019901	0.994	protein kinase binding
GO:0061630	0.958	ubiquitin protein ligase activity
GO:0008432	0.536	JUN kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.985	regulation of biological process
GO:0050794	0.980	regulation of cellular process
GO:0071704	0.925	organic substance metabolic process
GO:0044238	0.925	primary metabolic process
GO:0043170	0.923	macromolecule metabolic process
GO:0006807	0.917	nitrogen compound metabolic process
GO:0019538	0.913	protein metabolic process
GO:0009987	0.806	cellular process
GO:0048518	0.802	positive regulation of biological process
GO:0048583	0.776	regulation of response to stimulus
GO:0023051	0.770	regulation of signaling
GO:0010646	0.770	regulation of cell communication
GO:0009966	0.752	regulation of signal transduction
GO:0048584	0.727	positive regulation of response to stimulus
GO:0032446	0.725	protein modification by small protein conjugation
GO:0016567	0.724	protein ubiquitination
GO:0051179	0.711	localization
GO:0048522	0.669	positive regulation of cellular process
GO:1902531	0.640	regulation of intracellular signal transduction
GO:0023056	0.567	positive regulation of signaling
GO:0051640	0.531	organelle localization
GO:0080135	0.522	regulation of cellular response to stress
GO:0010647	0.503	positive regulation of cell communication
GO:1902533	0.442	positive regulation of intracellular signal transduction
GO:0070302	0.326	regulation of stress-activated protein kinase signaling cascade

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0098588	0.998	bounding membrane of organelle
GO:0005768	0.997	endosome
GO:0005654	0.997	nucleoplasm
GO:0005829	0.989	cytosol
GO:0005764	0.985	lysosome
GO:0098852	0.974	lytic vacuole membrane
GO:0005765	0.957	lysosomal membrane
GO:0012506	0.606	vesicle membrane
GO:0030659	0.601	cytoplasmic vesicle membrane
GO:0010008	0.562	endosome membrane
GO:0005783	0.428	endoplasmic reticulum

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.998	Transferases.

[back to server]