StarFunc result for job id O43581

User Input

>input (403 residues)
MYRDPEAASPGAPSRDVLLVSAIITVSLSVTVVLCGLCHWCQRKLGKRYKNSLETVGTPD
SGRGRSEKKAIKLPAGGKAVNTAPVPGQTPHDESDRRTEPRSSVSDLVNSLTSEMLMLSP
GSEEDEAHEGCSRENLGRIQFSVGYNFQESTLTVKIMKAQELPAKDFSGTSDPFVKIYLL
PDKKHKLETKVKRKNLNPHWNETFLFEGFPYEKVVQRILYLQVLDYDRFSRNDPIGEVSI
PLNKVDLTQMQTFWKDLKPCSDGSGSRGELLLSLCYNPSANSIIVNIIKARNLKAMDIGG
TSDPYVKVWLMYKDKRVEKKKTVTMKRNLNPIFNESFAFDIPTEKLRETTIIITVMDKDK
LSRNDVIGKIYLSWKSGPGEVKHWKDMIARPRQPVAQWHQLKA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43581	1.000	1.000	5.964E-73	403	1.000	1.000	O43581.pdb.gz	SYT7_HUMAN Synaptotagmin-7 OS=Homo sapiens OX=9606 GN=SYT7 PE=1 SV=3
2	AFDB:P21521	0.368	0.315	5.399E-40	474	0.362	0.308	P21521.pdb.gz	SY65_DROME Synaptotagmin 1 OS=Drosophila melanogaster OX=7227 GN=Syt1 PE=1 SV=3
3	AFDB:Q62746	0.389	0.316	4.145E-39	511	0.402	0.317	Q62746.pdb.gz	SYT6_RAT Synaptotagmin-6 OS=Rattus norvegicus OX=10116 GN=Syt6 PE=1 SV=1
4	AFDB:Q86SS6	0.348	0.286	6.634E-39	491	0.370	0.303	Q86SS6.pdb.gz	SYT9_HUMAN Synaptotagmin-9 OS=Homo sapiens OX=9606 GN=SYT9 PE=1 SV=1
5	AFDB:P41823	0.395	0.379	1.379E-38	428	0.380	0.357	P41823.pdb.gz	SY65_APLCA Synaptotagmin-1 OS=Aplysia californica OX=6500 GN=SYT1 PE=1 SV=2
6	AFDB:Q95QH7	0.354	0.324	5.654E-38	443	0.375	0.341	Q95QH7.pdb.gz	Q95QH7_CAEEL C2 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=snt-1 PE=1 SV=1
7	AFDB:Q9BT88	0.367	0.347	1.115E-37	431	0.377	0.353	Q9BT88.pdb.gz	SYT11_HUMAN Synaptotagmin-11 OS=Homo sapiens OX=9606 GN=SYT11 PE=1 SV=2
8	AFDB:Q9H2B2	0.396	0.378	2.318E-37	425	0.357	0.339	Q9H2B2.pdb.gz	SYT4_HUMAN Synaptotagmin-4 OS=Homo sapiens OX=9606 GN=SYT4 PE=1 SV=1
9	AFDB:Q9BQG1	0.349	0.240	3.700E-36	590	0.362	0.247	Q9BQG1.pdb.gz	SYT3_HUMAN Synaptotagmin-3 OS=Homo sapiens OX=9606 GN=SYT3 PE=1 SV=1
10	AFDB:O00445	0.362	0.377	4.560E-36	386	0.347	0.363	O00445.pdb.gz	SYT5_HUMAN Synaptotagmin-5 OS=Homo sapiens OX=9606 GN=SYT5 PE=1 SV=2
11	PDB:3pfqA	0.288	0.224	1.093E-10	523	0.127	0.098	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
12	PDB:6kxkD	0.200	0.151	3.108E-10	553	0.122	0.089	6kxkD.pdb.gz	Crystal Structure of an Arabidopsis Copine providing insights into this protein family
13	PDB:5iz5B	0.228	0.126	4.012E-8	746	0.107	0.058	5iz5B.pdb.gz
14	PDB:5iz5A	0.212	0.116	1.025E-6	757	0.104	0.055	5iz5A.pdb.gz
15	PDB:5ixcA	0.231	0.139	1.402E-6	684	0.107	0.063	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
16	PDB:5izrC	0.218	0.136	4.427E-6	659	0.097	0.059	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
17	PDB:5a50A	0.203	0.473	5.749E-6	165	0.084	0.206	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
18	PDB:1cjyA	0.215	0.140	3.399E-5	633	0.062	0.039	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
19	PDB:4rj9A	0.198	0.472	1.323E-4	161	0.074	0.186	4rj9A.pdb.gz
20	PDB:5a52A	0.191	0.473	1.810E-4	154	0.074	0.195	5a52A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D4P8S0	0.0	549	488	0.663	0.547	D4P8S0_DANRE Synaptotagmin VIIb OS=Danio rerio OX=7955 GN=syt7 PE=2 SV=1
2	O43581	0.0	836	403	1.000	1.000	SYT7_HUMAN Synaptotagmin-7 OS=Homo sapiens OX=9606 GN=SYT7 PE=1 SV=3
3	Q62747	0.0	828	403	0.988	0.988	SYT7_RAT Synaptotagmin-7 OS=Rattus norvegicus OX=10116 GN=Syt7 PE=1 SV=1
4	Q9R0N7	0.0	825	403	0.983	0.983	SYT7_MOUSE Synaptotagmin-7 OS=Mus musculus OX=10090 GN=Syt7 PE=1 SV=1
5	Q59DP7	2.94e-116	342	283	0.397	0.565	Q59DP7_DROME Synaptotagmin 7, isoform F OS=Drosophila melanogaster OX=7227 GN=Syt7 PE=4 SV=1
6	Q9V4C4	2.67e-115	344	416	0.397	0.385	Q9V4C4_DROME Synaptotagmin 7, isoform A OS=Drosophila melanogaster OX=7227 GN=Syt7 PE=1 SV=4
7	P46097	2.66e-91	283	422	0.340	0.325	SYT2_MOUSE Synaptotagmin-2 OS=Mus musculus OX=10090 GN=Syt2 PE=1 SV=1
8	P29101	7.26e-91	282	422	0.340	0.325	SYT2_RAT Synaptotagmin-2 OS=Rattus norvegicus OX=10116 GN=Syt2 PE=1 SV=1
9	Q8N9I0	8.24e-91	281	419	0.340	0.327	SYT2_HUMAN Synaptotagmin-2 OS=Homo sapiens OX=9606 GN=SYT2 PE=1 SV=2
10	P21521	1.22e-87	275	474	0.325	0.276	SY65_DROME Synaptotagmin 1 OS=Drosophila melanogaster OX=7227 GN=Syt1 PE=1 SV=3
11	P21707	5.21e-86	270	421	0.320	0.306	SYT1_RAT Synaptotagmin-1 OS=Rattus norvegicus OX=10116 GN=Syt1 PE=1 SV=3
12	P21579	5.66e-86	269	422	0.320	0.306	SYT1_HUMAN Synaptotagmin-1 OS=Homo sapiens OX=9606 GN=SYT1 PE=1 SV=1
13	P46096	6.12e-86	269	421	0.320	0.306	SYT1_MOUSE Synaptotagmin-1 OS=Mus musculus OX=10090 GN=Syt1 PE=1 SV=1
14	P48018	7.25e-86	269	422	0.320	0.306	SYT1_BOVIN Synaptotagmin-1 OS=Bos taurus OX=9913 GN=SYT1 PE=1 SV=1
15	P41823	1.20e-85	269	428	0.342	0.322	SY65_APLCA Synaptotagmin-1 OS=Aplysia californica OX=6500 GN=SYT1 PE=1 SV=2
16	A0A075F932	3.43e-85	267	421	0.323	0.309	SYT1_ANSCY Synaptotagmin-1 OS=Anser cygnoides OX=8845 GN=SYT1 PE=2 SV=1
17	Q9R0N8	8.03e-82	261	511	0.328	0.258	SYT6_MOUSE Synaptotagmin-6 OS=Mus musculus OX=10090 GN=Syt6 PE=1 SV=2
18	P34693	1.28e-81	259	441	0.333	0.304	SYT1_CAEEL Synaptotagmin-1 OS=Caenorhabditis elegans OX=6239 GN=snt-1 PE=2 SV=1
19	Q62746	2.34e-81	260	511	0.325	0.256	SYT6_RAT Synaptotagmin-6 OS=Rattus norvegicus OX=10116 GN=Syt6 PE=1 SV=1
20	Q5T7P8	2.85e-81	260	510	0.325	0.257	SYT6_HUMAN Synaptotagmin-6 OS=Homo sapiens OX=9606 GN=SYT6 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	2e-50	180.7	C2 domain
2	PF15627 CEP76-C2	1.4e+02	13.5	CEP76 C2 domain
3	PF15050 SCIMP	3.4e+02	13.1	SCIMP protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 28737.XP_006899898.1

Rank	PPI partner	STRING score	Description
1	28737.XP_006883037.1	0.890	Synaptosomal-associated protein 23 isoform X1
2	28737.XP_006889057.1	0.890	Synaptosomal-associated protein 23-like isoform X1
3	28737.XP_006894310.1	0.890	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 4 Proteins
4	28737.XP_006894292.1	0.839	Secretogranin-1
5	28737.XP_006893651.1	0.827	Complexin-1
6	28737.XP_006879169.1	0.821	chromogranin-A
7	28737.XP_006893974.1	0.819	Synaptosomal-associated protein 47
8	28737.XP_006894626.1	0.793	Synaptosomal-associated protein 29
9	28737.XP_006896566.1	0.782	Syntaxin-4 isoform X1
10	28737.XP_006884693.1	0.777	Stonin-2-like
11	28737.XP_006900021.1	0.770	Vesicle-associated membrane protein 7-like isoform X1
12	28737.XP_006887488.1	0.767	Vesicle-associated membrane protein 4
13	28737.XP_006880971.1	0.765	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 13 Proteins
14	28737.XP_006889742.1	0.739	syntaxin-1A
15	28737.XP_006891349.1	0.731	Vesicle-associated membrane protein 1
16	28737.XP_006899242.1	0.726	Uncharacterized protein LOC102858437
17	28737.XP_006900453.1	0.723	Vesicle-associated membrane protein 8
18	28737.XP_006884781.1	0.722	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 7 Proteins
19	28737.XP_006901940.1	0.705	Epidermal growth factor receptor kinase substrate 8-like protein 1
20	28737.XP_006885947.1	0.696	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 mRNAs, 23 Proteins

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005543	0.998	phospholipid binding
GO:0000149	0.998	SNARE binding
GO:0043167	0.997	ion binding
GO:0005544	0.978	calcium-dependent phospholipid binding
GO:0019905	0.748	syntaxin binding
GO:0030276	0.671	clathrin binding
GO:0043168	0.462	anion binding
GO:1901981	0.452	phosphatidylinositol phosphate binding
GO:1902936	0.412	phosphatidylinositol bisphosphate binding
GO:0005509	0.367	calcium ion binding
GO:0042802	0.351	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0006810	0.995	transport
GO:0065008	0.994	regulation of biological quality
GO:1903530	0.987	regulation of secretion by cell
GO:0016043	0.986	cellular component organization
GO:0060627	0.986	regulation of vesicle-mediated transport
GO:0045055	0.985	regulated exocytosis
GO:0017158	0.978	regulation of calcium ion-dependent exocytosis
GO:0017156	0.974	calcium-ion regulated exocytosis
GO:0061024	0.939	membrane organization
GO:0051047	0.937	positive regulation of secretion
GO:0051641	0.909	cellular localization
GO:0051649	0.902	establishment of localization in cell
GO:0090087	0.899	regulation of peptide transport
GO:0048522	0.897	positive regulation of cellular process
GO:0010256	0.872	endomembrane system organization
GO:0001505	0.862	regulation of neurotransmitter levels
GO:0060341	0.857	regulation of cellular localization
GO:0050708	0.838	regulation of protein secretion
GO:0007267	0.836	cell-cell signaling
GO:0007009	0.836	plasma membrane organization
GO:0099536	0.796	synaptic signaling
GO:0050896	0.773	response to stimulus
GO:0044085	0.765	cellular component biogenesis
GO:0006836	0.760	neurotransmitter transport
GO:0007268	0.752	chemical synaptic transmission
GO:0051128	0.751	regulation of cellular component organization
GO:0022607	0.747	cellular component assembly
GO:0042060	0.725	wound healing
GO:0001778	0.720	plasma membrane repair
GO:0023061	0.712	signal release
GO:0099643	0.693	signal release from synapse
GO:0023051	0.664	regulation of signaling
GO:1903532	0.663	positive regulation of secretion by cell
GO:0010646	0.662	regulation of cell communication
GO:0016050	0.619	vesicle organization
GO:0007269	0.607	neurotransmitter secretion
GO:0090174	0.585	organelle membrane fusion
GO:0099003	0.529	vesicle-mediated transport in synapse
GO:0099504	0.484	synaptic vesicle cycle
GO:0071702	0.458	organic substance transport
GO:0033036	0.455	macromolecule localization
GO:0016079	0.432	synaptic vesicle exocytosis
GO:0006906	0.422	vesicle fusion
GO:0046883	0.385	regulation of hormone secretion
GO:0002791	0.339	regulation of peptide secretion
GO:0090276	0.328	regulation of peptide hormone secretion
GO:1903307	0.305	positive regulation of regulated secretory pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031982	1.000	vesicle
GO:0012505	0.998	endomembrane system
GO:0005886	0.997	plasma membrane
GO:0005773	0.995	vacuole
GO:0098793	0.989	presynapse
GO:0120025	0.985	plasma membrane bounded cell projection
GO:0043005	0.976	neuron projection
GO:0005764	0.948	lysosome
GO:0099503	0.933	secretory vesicle
GO:0031090	0.922	organelle membrane
GO:0098588	0.902	bounding membrane of organelle
GO:0030133	0.884	transport vesicle
GO:0070382	0.871	exocytic vesicle
GO:0008021	0.860	synaptic vesicle
GO:0030141	0.836	secretory granule
GO:0005576	0.496	extracellular region
GO:0030659	0.433	cytoplasmic vesicle membrane
GO:0098590	0.426	plasma membrane region
GO:0030424	0.423	axon
GO:0150034	0.378	distal axon
GO:0097060	0.378	synaptic membrane
GO:0043679	0.316	axon terminus
GO:0030658	0.305	transport vesicle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]