StarFunc result for job id O43592

User Input

>input (962 residues)
MDEQALLGLNPNADSDFRQRALAYFEQLKISPDAWQVCAEALAQRTYSDDHVKFFCFQVL
EHQVKYKYSELTTVQQQLIRETLISWLQAQMLNPQPEKTFIRNKAAQVFALLFVTEYLTK
WPKFFFDILSVVDLNPRGVDLYLRILMAIDSELVDRDVVHTSEEARRNTLIKDTMREQCI
PNLVESWYQILQNYQFTNSEVTCQCLEVVGAYVSWIDLSLIANDRFINMLLGHMSIEVLR
EEACDCLFEVVNKGMDPVDKMKLVESLCQVLQSAGFFSIDQEEDVDFLARFSKLVNGMGQ
SLIVSWSKLIKNGDIKNAQEALQAIETKVALMLQLLIHEDDDISSNIIGFCYDYLHILKQ
LTVLSDQQKANVEAIMLAVMKKLTYDEEYNFENEGEDEAMFVEYRKQLKLLLDRLAQVSP
ELLLASVRRVFSSTLQNWQTTRFMEVEVAIRLLYMLAEALPVSHGAHFSGDVSKASALQD
MMRTLVTSGVSSYQHTSVTLEFFETVVRYEKFFTVEPQHIPCVLMAFLDHRGLRHSSAKV
RSRTAYLFSRFVKSLNKQMNPFIEDILNRIQDLLELSPPENGHQSLLSSDDQLFIYETAG
VLIVNSEYPAERKQALMRNLLTPLMEKFKILLEKLMLAQDEERQASLADCLNHAVGFASR
TSKAFSNKQTVKQCGCSEVYLDCLQTFLPALSCPLQKDILRSGVRTFLHRMIICLEEEVL
PFIPSASEHMLKDCEAKDLQEFIPLINQITAKFKIQVSPFLQQMFMPLLHAIFEVLLRPA
EENDQSAALEKQMLRRSYFAFLQTVTGSGMSEVIANQGAENVERVLVTVIQGAVEYPDPI
AQKTCFIILSKLVELWGGKDGPVGFADFVYKHIVPACFLAPLKQTFDLADAQTVLALSEC
AVTLKTIHLKRGPECVQYLQQEYLPSLQVAPEIIQEFCQALQQPDAKVFKNYLKVFFQRA
KP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43592	1.000	1.000	0.000	962	1.000	1.000	O43592.pdb.gz	XPOT_HUMAN Exportin-T OS=Homo sapiens OX=9606 GN=XPOT PE=1 SV=2
2	AFDB:O94258	0.866	0.853	8.606E-39	978	0.270	0.266	O94258.pdb.gz	XPOT_SCHPO Exportin-T OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=los1 PE=1 SV=1
3	AFDB:Q7PC79	0.882	0.860	1.060E-38	988	0.275	0.268	Q7PC79.pdb.gz	XPOT_ARATH Exportin-T OS=Arabidopsis thaliana OX=3702 GN=PSD PE=2 SV=1
4	PDB:3icqT	0.829	0.839	3.140E-31	949	0.251	0.254	3icqT.pdb.gz	Structures of the tRNA export factor in the nuclear and cytosolic states
5	AFDB:P33418	0.865	0.763	4.670E-30	1100	0.206	0.180	P33418.pdb.gz	XPOT_YEAST Exportin-T OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LOS1 PE=1 SV=1
6	AFDB:Q586K4	0.713	0.580	2.004E-29	1219	0.219	0.173	Q586K4.pdb.gz	Q586K4_TRYB2 Exportin-T OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=25N14.145 PE=3 SV=1
7	AFDB:P14068	0.700	0.634	1.475E-17	1078	0.147	0.131	P14068.pdb.gz	XPO1_SCHPO Exportin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=xpo1 PE=1 SV=3
8	AFDB:A0A1D8PRR9	0.685	0.623	2.160E-17	1079	0.142	0.127	A0A1D8PRR9.pdb.gz	A0A1D8PRR9_CANAL Exportin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CRM1 PE=3 SV=1
9	AFDB:C8VRM0	0.688	0.626	2.160E-17	1072	0.149	0.133	C8VRM0.pdb.gz	C8VRM0_EMENI Exportin 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_01401 PE=3 SV=1
10	PDB:3wyfC	0.660	0.618	3.071E-17	1040	0.153	0.141	3wyfC.pdb.gz	Structural insights into how yrb2p accelerates the assembly of the xpo1p nuclear export complex
11	AFDB:A0A2R8RNP8	0.639	0.579	3.509E-17	1081	0.154	0.137	A0A2R8RNP8.pdb.gz
12	PDB:5uwuC	0.644	0.624	9.643E-17	998	0.139	0.134	5uwuC.pdb.gz	Nuclear export receptor CRM1 recognizes diverse conformations in nuclear export signals.
13	AFDB:P30822	0.666	0.602	1.102E-16	1084	0.149	0.132	P30822.pdb.gz	XPO1_YEAST Exportin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CRM1 PE=1 SV=1
14	PDB:3gjxA	0.640	0.598	3.601E-16	1041	0.155	0.143	3gjxA.pdb.gz	Crystal Structure of the Nuclear Export Receptor CRM1 in Complex with Snurportin1 and RanGTP.
15	PDB:2xwuB	0.718	0.753	5.653E-16	910	0.141	0.149	2xwuB.pdb.gz
16	PDB:6gx9A	0.610	0.638	1.019E-15	912	0.147	0.155	6gx9A.pdb.gz	Differential role for phosphorylation in alternative polyadenylation function versus nuclear import of SR-like protein CPSF6.
17	PDB:4c0qA	0.674	0.734	1.970E-15	871	0.149	0.164	4c0qA.pdb.gz	Structural Basis for Nuclear Import of Splicing Factors by Human Transportin 3.
18	PDB:5yu7A	0.546	0.486	3.677E-15	1118	0.170	0.147	5yu7A.pdb.gz
19	PDB:2x1gF	0.629	0.668	4.402E-13	896	0.130	0.140	2x1gF.pdb.gz
20	PDB:3gb8A	0.620	0.623	1.588E-12	958	0.146	0.146	3gb8A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43592	0.0	1987	962	1.000	1.000	XPOT_HUMAN Exportin-T OS=Homo sapiens OX=9606 GN=XPOT PE=1 SV=2
2	F8WDU6	1.62e-141	421	201	0.209	1.000	F8WDU6_HUMAN Exportin-T (Fragment) OS=Homo sapiens OX=9606 GN=XPOT PE=1 SV=8
3	Q7PC79	9.82e-113	372	988	0.279	0.271	XPOT_ARATH Exportin-T OS=Arabidopsis thaliana OX=3702 GN=PSD PE=2 SV=1
4	O94258	1.58e-100	339	978	0.281	0.276	XPOT_SCHPO Exportin-T OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=los1 PE=1 SV=1
5	P33418	4.38e-39	160	1100	0.221	0.194	XPOT_YEAST Exportin-T OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LOS1 PE=1 SV=1
6	Q586K4	3.74e-14	79.7	1219	0.062	0.049	Q586K4_TRYB2 Exportin-T OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=25N14.145 PE=3 SV=1
7	Q9HAV4	7.05e-07	55.8	1204	0.065	0.052	XPO5_HUMAN Exportin-5 OS=Homo sapiens OX=9606 GN=XPO5 PE=1 SV=1
8	Q924C1	1.81e-06	54.7	1204	0.055	0.044	XPO5_MOUSE Exportin-5 OS=Mus musculus OX=10090 GN=Xpo5 PE=1 SV=1
9	F4IZR5	2.14e-06	54.3	1076	0.064	0.058	XPO1B_ARATH Protein EXPORTIN 1B OS=Arabidopsis thaliana OX=3702 GN=XPO1B PE=2 SV=1
10	Q9BP41	1.48e-05	51.6	1241	0.074	0.057	Q9BP41_DROME RanBP21 OS=Drosophila melanogaster OX=7227 GN=Ranbp21 PE=1 SV=1
11	Q99189	3.53e-05	50.4	972	0.094	0.093	MTR10_YEAST mRNA transport regulator MTR10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MTR10 PE=1 SV=1
12	Q9W5G1	7.02e-05	49.3	1047	0.031	0.029	Q9W5G1_DROME Ellipsoid body open, isoform A OS=Drosophila melanogaster OX=7227 GN=ebo PE=2 SV=2
13	X2J9Y4	7.27e-05	49.3	1054	0.031	0.028	X2J9Y4_DROME Ellipsoid body open, isoform C OS=Drosophila melanogaster OX=7227 GN=ebo PE=3 SV=1
14	O46055	7.60e-05	49.3	1060	0.032	0.029	O46055_DROME EG:165H7.3 protein OS=Drosophila melanogaster OX=7227 GN=ebo PE=3 SV=2
15	X2JDN0	7.65e-05	49.3	1053	0.031	0.028	X2JDN0_DROME Ellipsoid body open, isoform B OS=Drosophila melanogaster OX=7227 GN=ebo PE=3 SV=1
16	Q8T9F5	9.29e-05	48.9	1047	0.032	0.030	Q8T9F5_DROME SD03282p OS=Drosophila melanogaster OX=7227 GN=ebo PE=2 SV=1
17	Q9SMV6	2.84e-04	47.4	1075	0.059	0.053	XPO1A_ARATH Protein EXPORTIN 1A OS=Arabidopsis thaliana OX=3702 GN=XPO1 PE=1 SV=1
18	C8VRM0	0.001	45.1	1072	0.055	0.049	C8VRM0_EMENI Exportin 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_01401 PE=3 SV=1
19	Q9USZ2	0.002	44.7	955	0.051	0.051	YNR7_SCHPO Uncharacterized protein C11G11.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC11G11.07 PE=4 SV=2
20	Q9TVM2	0.025	40.8	1063	0.054	0.049	XPO1_DROME Exportin-1 OS=Drosophila melanogaster OX=7227 GN=emb PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03750 Csm2_III-A	1.2e+02	14.9	Csm2 Type III-A
2	PF19282 Exportin-T	2.8e-117	404.3	Exportin-T
3	PF03810 IBN_N	0.015	26.5	Importin-beta N-terminal domain
4	PF08389 Xpo1	4.5e-38	142.1	Exportin 1-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000327821

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000446215	0.997	GTP-binding nuclear protein Ran
2	9606.ENSP00000229179	0.970	Nuclear pore complex protein Nup107
3	9606.ENSP00000444029	0.969	Nuclear pore complex protein Nup153
4	9606.ENSP00000352400	0.963	Nuclear pore complex protein Nup214
5	9606.ENSP00000382779	0.963	Nucleoporin SEH1
6	9606.ENSP00000283195	0.962	E3 SUMO-protein ligase RanBP2
7	9606.ENSP00000371155	0.958	Nucleoporin p58/p45
8	9606.ENSP00000285968	0.957	Nuclear pore complex protein Nup205
9	9606.ENSP00000316032	0.955	Nuclear pore complex protein Nup98-Nup96
10	9606.ENSP00000379182	0.955	mRNA export factor
11	9606.ENSP00000373312	0.954	Protein SEC13 homolog
12	9606.ENSP00000231498	0.950	Nuclear pore complex protein Nup155
13	9606.ENSP00000245544	0.946	Nuclear pore complex protein Nup85
14	9606.ENSP00000310668	0.942	Nuclear pore complex protein Nup93
15	9606.ENSP00000448054	0.942	Nucleoporin Nup37
16	9606.ENSP00000471191	0.939	Nuclear pore glycoprotein p62
17	9606.ENSP00000264883	0.937	Nucleoporin p54
18	9606.ENSP00000356448	0.934	Nucleoprotein TPR
19	9606.ENSP00000367721	0.932	Nuclear pore complex protein Nup160
20	9606.ENSP00000458954	0.931	Nuclear pore complex protein Nup88

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000049	1.000	tRNA binding
GO:0140142	0.561	nucleocytoplasmic carrier activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0006405	0.976	RNA export from nucleus
GO:0071704	0.323	organic substance metabolic process
GO:0008104	0.309	protein localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.999	endomembrane system
GO:0005829	0.998	cytosol
GO:0005654	0.998	nucleoplasm
GO:0032991	0.997	protein-containing complex
GO:0005643	0.988	nuclear pore
GO:0016020	0.867	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]