StarFunc result for job id O43593

User Input

>input (1189 residues)
MESTPSFLKGTPTWEKTAPENGIVRQEPGSPPRDGLHHGPLCLGEPAPFWRGVLSTPDSW
LPPGFPQGPKDMLPLVEGEGPQNGERKVNWLGSKEGLRWKEAMLTHPLAFCGPACPPRCG
PLMPEHSGGHLKSDPVAFRPWHCPFLLETKILERAPFWVPTCLPPYLVSGLPPEHPCDWP
LTPHPWVYSGGQPKVPSAFSLGSKGFYYKDPSIPRLAKEPLAAAEPGLFGLNSGGHLQRA
GEAERPSLHQRDGEMGAGRQQNPCPLFLGQPDTVPWTSWPACPPGLVHTLGNVWAGPGDG
NLGYQLGPPATPRCPSPEPPVTQRGCCSSYPPTKGGGLGPCGKCQEGLEGGASGASEPSE
EVNKASGPRACPPSHHTKLKKTWLTRHSEQFECPRGCPEVEERPVARLRALKRAGSPEVQ
GAMGSPAPKRPPDPFPGTAEQGAGGWQEVRDTSIGNKDVDSGQHDEQKGPQDGQASLQDP
GLQDIPCLALPAKLAQCQSCAQAAGEGGGHACHSQQVRRSPLGGELQQEEDTATNSSSEE
GPGSGPDSRLSTGLAKHLLSGLGDRLCRLLRREREALAWAQREGQGPAVTEDSPGIPRCC
SRCHHGLFNTHWRCPRCSHRLCVACGRVAGTGRAREKAGFQEQSAEECTQEAGHAACSLM
LTQFVSSQALAELSTAMHQVWVKFDIRGHCPCQADARVWAPGDAGQQKESTQKTPPTPQP
SCNGDTHRTKSIKEETPDSAETPAEDRAGRGPLPCPSLCELLASTAVKLCLGHERIHMAF
APVTPALPSDDRITNILDSIIAQVVERKIQEKALGPGLRAGPGLRKGLGLPLSPVRPRLP
PPGALLWLQEPQPCPRRGFHLFQEHWRQGQPVLVSGIQRTLQGNLWGTEALGALGGQVQA
LSPLGPPQPSSLGSTTFWEGFSWPELRPKSDEGSVLLLHRALGDEDTSRVENLAASLPLP
EYCALHGKLNLASYLPPGLALRPLEPQLWAAYGVSPHRGHLGTKNLCVEVADLVSILVHA
DTPLPAWHRAQKDFLSGLDGEGLWSPGSQVSTVWHVFRAQDAQRIRRFLQMVCPAGAGAL
EPGAPGSCYLDAGLRRRLREEWGVSCWTLLQAPGEAVLVPAGAPHQVQGLVSTVSVTQHF
LSPETSALSAQLCHQGPSLPPDCHLLYAQMDWAVFQAVKVAVGTLQEAK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43593	1.000	1.000	0.000	1189	1.000	1.000	O43593.pdb.gz	HAIR_HUMAN Lysine-specific demethylase hairless OS=Homo sapiens OX=9606 GN=HR PE=1 SV=5
2	AFDB:Q61645	0.483	0.486	0.000	1182	0.796	0.800	Q61645.pdb.gz	HAIR_MOUSE Lysine-specific demethylase hairless OS=Mus musculus OX=10090 GN=Hr PE=2 SV=2
3	AFDB:Q69ZK6	0.361	0.193	3.534E-36	2350	0.271	0.137	Q69ZK6.pdb.gz	JHD2C_MOUSE Probable JmjC domain-containing histone demethylation protein 2C OS=Mus musculus OX=10090 GN=Jmjd1c PE=1 SV=3
4	AFDB:Q7LBC6	0.367	0.257	5.132E-36	1761	0.247	0.167	Q7LBC6.pdb.gz	KDM3B_HUMAN Lysine-specific demethylase 3B OS=Homo sapiens OX=9606 GN=KDM3B PE=1 SV=2
5	AFDB:G3V9U4	0.218	0.195	5.720E-13	1356	0.186	0.163	G3V9U4.pdb.gz	G3V9U4_RAT [histone H3]-trimethyl-L-lysine(27) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm6b PE=3 SV=4
6	AFDB:A0A1D5NSI1	0.194	0.120	1.243E-10	1996	0.169	0.101	A0A1D5NSI1.pdb.gz
7	AFDB:E9QG91	0.201	0.142	3.075E-10	1719	0.172	0.119	E9QG91.pdb.gz
8	PDB:3al5B	0.163	0.519	2.765E-8	311	0.033	0.125	3al5B.pdb.gz	Crystal structure of a novel JmjC-domain-containing protein, TYW5, involved in tRNA modification.
9	PDB:4b7eA	0.162	0.482	3.762E-7	349	0.034	0.117	4b7eA.pdb.gz	Substrate selectivity analyses of factor inhibiting hypoxia-inducible factor.
10	PDB:4qszA	0.159	0.261	1.962E-6	686	0.036	0.063	4qszA.pdb.gz	Crystal structure of mouse JMJd7 fused with maltose-binding protein
11	PDB:3al5C	0.140	0.504	2.429E-6	284	0.034	0.144	3al5C.pdb.gz	Crystal structure of a novel JmjC-domain-containing protein, TYW5, involved in tRNA modification.
12	PDB:5nfnB	0.165	0.521	3.526E-6	318	0.041	0.154	5nfnB.pdb.gz	(3S)-Lysyl hydroxylation of TRAFAC GTPases is catalyzed by the human Jumonji-C oxygenase JMJD7.
13	AFDB:Q9VT00	0.162	0.088	8.525E-6	2351	0.164	0.083	Q9VT00.pdb.gz	Q9VT00_DROME Jumonji, AT rich interactive domain 2 OS=Drosophila melanogaster OX=7227 GN=Jarid2 PE=1 SV=3
14	PDB:7yxgA	0.145	0.459	3.134E-5	313	0.034	0.131	7yxgA.pdb.gz	Conservation of the unusual dimeric JmjC fold of JMJD7 from Drosophila melanogaster to humans.
15	PDB:4bxfA	0.134	0.328	6.607E-5	425	0.029	0.082	4bxfA.pdb.gz	Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
16	PDB:4cclB	0.119	0.327	5.278E-4	372	0.036	0.116	4cclB.pdb.gz	Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
17	PDB:4bu2A	0.120	0.337	1.453E-3	379	0.025	0.079	4bu2A.pdb.gz	Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
18	AFDB:Q9VI93	0.055	0.063	5.378E-3	946	0.105	0.132	Q9VI93.pdb.gz	RN_DROME Zinc finger protein rotund OS=Drosophila melanogaster OX=7227 GN=rn PE=1 SV=2
19	PDB:1ipkC	0.063	0.192	6.457E-3	379	0.009	0.029	1ipkC.pdb.gz
20	AFDB:Q63187	0.048	0.062	7.404E-3	773	0.097	0.149	Q63187.pdb.gz	ELOA1_RAT Elongin-A OS=Rattus norvegicus OX=10116 GN=Eloa PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43593	0.0	2376	1189	1.000	1.000	HAIR_HUMAN Lysine-specific demethylase hairless OS=Homo sapiens OX=9606 GN=HR PE=1 SV=5
2	P97609	0.0	1803	1181	0.789	0.794	HAIR_RAT Lysine-specific demethylase hairless OS=Rattus norvegicus OX=10116 GN=Hr PE=1 SV=2
3	Q61645	0.0	1810	1182	0.796	0.801	HAIR_MOUSE Lysine-specific demethylase hairless OS=Mus musculus OX=10090 GN=Hr PE=2 SV=2
4	Q63679	8.39e-63	236	1214	0.181	0.177	KDM3A_RAT Lysine-specific demethylase 3A OS=Rattus norvegicus OX=10116 GN=Kdm3a PE=2 SV=1
5	Q15652	2.29e-52	204	2540	0.141	0.066	JHD2C_HUMAN Probable JmjC domain-containing histone demethylation protein 2C OS=Homo sapiens OX=9606 GN=JMJD1C PE=1 SV=2
6	Q69ZK6	4.22e-51	201	2350	0.132	0.067	JHD2C_MOUSE Probable JmjC domain-containing histone demethylation protein 2C OS=Mus musculus OX=10090 GN=Jmjd1c PE=1 SV=3
7	Q7LBC6	3.23e-49	194	1761	0.119	0.080	KDM3B_HUMAN Lysine-specific demethylase 3B OS=Homo sapiens OX=9606 GN=KDM3B PE=1 SV=2
8	Q9VHC5	6.05e-48	187	854	0.164	0.228	Q9VHC5_DROME JmjC domain-containing histone demethylase 2, isoform A OS=Drosophila melanogaster OX=7227 GN=Kdm3 PE=2 SV=1
9	M0RDF1	7.22e-48	190	1724	0.114	0.078	M0RDF1_RAT Lysine-specific demethylase OS=Rattus norvegicus OX=10116 GN=Kdm3b PE=1 SV=2
10	A0A8I5ZXX2	8.67e-48	189	1762	0.114	0.077	A0A8I5ZXX2_RAT Lysine-specific demethylase OS=Rattus norvegicus OX=10116 GN=Kdm3b PE=3 SV=1
11	A0A8I6AC36	1.53e-47	189	1562	0.113	0.086	A0A8I6AC36_RAT Lysine-specific demethylase OS=Rattus norvegicus OX=10116 GN=Kdm3b PE=1 SV=1
12	Q6PCM1	2.96e-45	181	1323	0.113	0.101	KDM3A_MOUSE Lysine-specific demethylase 3A OS=Mus musculus OX=10090 GN=Kdm3a PE=1 SV=1
13	Q9Y4C1	1.34e-44	179	1321	0.111	0.100	KDM3A_HUMAN Lysine-specific demethylase 3A OS=Homo sapiens OX=9606 GN=KDM3A PE=1 SV=4
14	C0SUU8	4.74e-26	118	875	0.092	0.125	JMJ26_ARATH Lysine-specific demethylase JMJ26 OS=Arabidopsis thaliana OX=3702 GN=JMJ26 PE=2 SV=1
15	C0SV12	1.49e-23	110	883	0.084	0.113	JMJ29_ARATH Lysine-specific demethylase JMJ29 OS=Arabidopsis thaliana OX=3702 GN=JMJ29 PE=2 SV=1
16	Q9SSE9	1.11e-19	97.8	1027	0.080	0.093	JMJ25_ARATH Lysine-specific demethylase JMJ25 OS=Arabidopsis thaliana OX=3702 GN=JMJ25 PE=1 SV=1
17	F4JFK4	4.21e-15	83.2	1049	0.080	0.091	F4JFK4_ARATH Transcription factor jumonji (JmjC) domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=IBM1 PE=1 SV=1
18	F4HZD1	3.47e-11	70.1	944	0.034	0.043	JMJ24_ARATH E3 ubiquitin-protein ligase JMJ24 OS=Arabidopsis thaliana OX=3702 GN=JMJ24 PE=1 SV=1
19	Q8VYB9	2.06e-10	67.8	840	0.029	0.042	JMJ27_ARATH Lysine-specific demethylase JMJ27 OS=Arabidopsis thaliana OX=3702 GN=JMJ27 PE=1 SV=1
20	Q8H1S7	1.30e-09	65.1	927	0.034	0.044	JMJ28_ARATH Lysine-specific demethylase JMJ28 OS=Arabidopsis thaliana OX=3702 GN=JMJ28 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02373 JmjC	0.00057	31.7	JmjC domain, hydroxylase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000370826

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000463151	0.683	Retinol-binding protein 3
2	9606.ENSP00000262844	0.671	AMME syndrome candidate gene 1 protein
3	9606.ENSP00000447651	0.628	Transcription termination factor 2, mitochondrial
4	9606.ENSP00000362649	0.508	Histone deacetylase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003824	0.491	catalytic activity
GO:0140096	0.462	catalytic activity, acting on a protein
GO:0016491	0.313	oxidoreductase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0080090	0.989	regulation of primary metabolic process
GO:0060255	0.989	regulation of macromolecule metabolic process
GO:0051171	0.989	regulation of nitrogen compound metabolic process
GO:0031323	0.989	regulation of cellular metabolic process
GO:0006355	0.980	regulation of DNA-templated transcription
GO:0045892	0.921	negative regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.577	protein-containing complex
GO:0005737	0.324	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.-.-.-	0.313	Oxidoreductases.

[back to server]