StarFunc result for job id O43597

User Input

>input (315 residues)
MEARAQSGNGSQPLLQTPRDGGRQRGEPDPRDALTQQVHVLSLDQIRAIRNTNEYTEGPT
VVPRPGLKPAPRPSTQHKHERLHGLPEHRQPPRLQHSQVHSSARAPLSRSISTVSSGSRS
STRTSTSSSSSEQRLLGSSFSSGPVADGIIRVQPKSELKPGELKPLSKEDLGLHAYRCED
CGKCKCKECTYPRPLPSDWICDKQCLCSAQNVIDYGTCVCCVKGLFYHCSNDDEDNCADN
PCSCSQSHCCTRWSAMGVMSLFLPCLWCYLPAKGCLKLCQGCYDRVNRPGCRCKNSNTVC
CKVPTVPPRNFEKPT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7Z783	0.423	0.380	8.896E-45	353	0.978	0.873	Q7Z783.pdb.gz	Q7Z783_HUMAN SPRY2 protein OS=Homo sapiens OX=9606 PE=1 SV=1
2	AFDB:O43609	0.449	0.443	2.061E-29	319	0.571	0.564	O43609.pdb.gz	SPY1_HUMAN Protein sprouty homolog 1 OS=Homo sapiens OX=9606 GN=SPRY1 PE=1 SV=2
3	AFDB:B5DFH3	0.458	0.461	9.065E-28	313	0.514	0.518	B5DFH3.pdb.gz	B5DFH3_RAT Sprouty RTK signaling antagonist 1 OS=Rattus norvegicus OX=10116 GN=Spry1 PE=2 SV=1
4	AFDB:F1QU39	0.395	0.413	2.260E-26	301	0.540	0.565	F1QU39.pdb.gz	F1QU39_DANRE Protein sprouty homolog 2 isoform X1 OS=Danio rerio OX=7955 GN=wu:fk66h11 PE=4 SV=1
5	AFDB:F1QZW4	0.399	0.405	1.865E-22	310	0.400	0.406	F1QZW4.pdb.gz
6	AFDB:Q5XJQ7	0.082	0.100	1.426	264	0.133	0.159	Q5XJQ7.pdb.gz	OSR1_DANRE Protein odd-skipped-related 1 OS=Danio rerio OX=7955 GN=osr1 PE=2 SV=1
7	AFDB:Q9VMR2	0.089	0.055	1.426	580	0.111	0.060	Q9VMR2.pdb.gz	Q9VMR2_DROME LP04777p OS=Drosophila melanogaster OX=7227 GN=mid PE=2 SV=1
8	AFDB:Q16600	0.082	0.059	1.519	458	0.121	0.083	Q16600.pdb.gz	ZN239_HUMAN Zinc finger protein 239 OS=Homo sapiens OX=9606 GN=ZNF239 PE=1 SV=3
9	AFDB:Q05917	0.119	0.126	1.954	289	0.127	0.138	Q05917.pdb.gz	HME2_CHICK Homeobox protein engrailed-2 OS=Gallus gallus OX=9031 GN=EN2 PE=1 SV=2
10	AFDB:A0A140VJR0	0.124	0.060	2.217	809	0.178	0.069	A0A140VJR0.pdb.gz	A0A140VJR0_HUMAN Phosphodiesterase OS=Homo sapiens OX=9606 GN=PDE4D PE=2 SV=1
11	PDB:3ajwA	0.084	0.185	4.046	134	0.035	0.082	3ajwA.pdb.gz
12	PDB:6ta5D	0.113	0.105	4.888	345	0.032	0.029	6ta5D.pdb.gz
13	PDB:2ilkA	0.127	0.233	5.207	155	0.038	0.077	2ilkA.pdb.gz	Crystal structure of human interleukin-10 at 1.6 A resolution and a model of a complex with its soluble receptor.
14	PDB:1mabG	0.131	0.288	7.137	124	0.032	0.081	1mabG.pdb.gz	The 2.8-A structure of rat liver F1-ATPase: configuration of a critical intermediate in ATP synthesis/hydrolysis.
15	PDB:4x51A	0.138	0.252	7.601	142	0.048	0.106	4x51A.pdb.gz
16	PDB:1is7A	0.088	0.126	8.096	194	0.025	0.041	1is7A.pdb.gz	Crystal structure of the stimulatory complex of GTP cyclohydrolase I and its feedback regulatory protein GFRP.
17	PDB:1r30B	0.056	0.056	9.782	313	0.016	0.016	1r30B.pdb.gz	Crystal structure of biotin synthase, an S-adenosylmethionine-dependent radical enzyme.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43597	0.0	642	315	1.000	1.000	SPY2_HUMAN Protein sprouty homolog 2 OS=Homo sapiens OX=9606 GN=SPRY2 PE=1 SV=1
2	Q7Z783	0.0	630	353	0.978	0.873	Q7Z783_HUMAN SPRY2 protein OS=Homo sapiens OX=9606 PE=1 SV=1
3	Q9QXV8	0.0	611	315	0.965	0.965	SPY2_MOUSE Protein sprouty homolog 2 OS=Mus musculus OX=10090 GN=Spry2 PE=1 SV=1
4	F1QU39	3.98e-99	295	301	0.549	0.575	F1QU39_DANRE Protein sprouty homolog 2 isoform X1 OS=Danio rerio OX=7955 GN=wu:fk66h11 PE=4 SV=1
5	Q4VBS7	1.62e-98	294	301	0.546	0.571	Q4VBS7_DANRE Protein sprouty homolog 2 OS=Danio rerio OX=7955 GN=zgc:110440 PE=2 SV=1
6	O43609	1.23e-86	264	319	0.549	0.542	SPY1_HUMAN Protein sprouty homolog 1 OS=Homo sapiens OX=9606 GN=SPRY1 PE=1 SV=2
7	B5DFH3	7.51e-70	221	313	0.521	0.524	B5DFH3_RAT Sprouty RTK signaling antagonist 1 OS=Rattus norvegicus OX=10116 GN=Spry1 PE=2 SV=1
8	Q9QXV9	1.69e-69	220	313	0.527	0.530	SPY1_MOUSE Protein sprouty homolog 1 OS=Mus musculus OX=10090 GN=Spry1 PE=1 SV=1
9	O43610	3.67e-68	216	288	0.394	0.431	SPY3_HUMAN Protein sprouty homolog 3 OS=Homo sapiens OX=9606 GN=SPRY3 PE=1 SV=2
10	Q9WTP2	1.74e-66	212	300	0.403	0.423	SPY4_MOUSE Protein sprouty homolog 4 OS=Mus musculus OX=10090 GN=Spry4 PE=1 SV=1
11	Q3UUD2	1.13e-65	209	288	0.390	0.427	SPRY3_MOUSE Protein sprouty homolog 3 OS=Mus musculus OX=10090 GN=Spry3 PE=1 SV=1
12	Q9C004	8.54e-65	207	299	0.397	0.418	SPY4_HUMAN Protein sprouty homolog 4 OS=Homo sapiens OX=9606 GN=SPRY4 PE=1 SV=2
13	Q90XH4	3.65e-62	201	310	0.422	0.429	Q90XH4_DANRE Sprouty4 OS=Danio rerio OX=7955 GN=sprouty4 PE=2 SV=1
14	O44783	1.35e-41	154	589	0.206	0.110	SPY_DROME Protein sprouty OS=Drosophila melanogaster OX=7227 GN=sty PE=1 SV=2
15	D6RHD2	4.96e-34	125	209	0.308	0.464	D6RHD2_HUMAN Sprouty RTK signaling antagonist 1 (Fragment) OS=Homo sapiens OX=9606 GN=SPRY1 PE=1 SV=1
16	F0JAK5	1.53e-10	63.9	404	0.083	0.064	F0JAK5_DROME LD31195p OS=Drosophila melanogaster OX=7227 GN=Spred PE=2 SV=1
17	Q7K0G4	1.55e-10	63.9	426	0.083	0.061	Q7K0G4_DROME SD10629p OS=Drosophila melanogaster OX=7227 GN=Spred PE=2 SV=1
18	A0A0B4KG11	1.76e-10	63.9	519	0.083	0.050	A0A0B4KG11_DROME Sprouty-related protein with EVH-1 domain, isoform C OS=Drosophila melanogaster OX=7227 GN=Spred PE=4 SV=1
19	Q7Z699	4.69e-08	56.2	444	0.076	0.054	SPRE1_HUMAN Sprouty-related, EVH1 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SPRED1 PE=1 SV=2
20	Q924S8	4.69e-08	56.2	444	0.076	0.054	SPRE1_MOUSE Sprouty-related, EVH1 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Spred1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05210 Sprouty	1.4e-34	130.3	Sprouty protein (Spry)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000019982

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000009017	0.994	Cbl proto-oncogene, E3 ubiquitin protein ligase
2	61853.ENSNLEP00000001019	0.982	Growth factor receptor-bound protein 2
3	61853.ENSNLEP00000000099	0.925	Protein tyrosine phosphatase, non-receptor type 11
4	61853.ENSNLEP00000004243	0.903	Uncharacterized protein
5	61853.ENSNLEP00000004247	0.903	Uncharacterized protein
6	61853.ENSNLEP00000024200	0.903	Uncharacterized protein
7	61853.ENSNLEP00000004655	0.834	Fibroblast growth factor receptor substrate 2
8	61853.ENSNLEP00000015961	0.826	annotation not available
9	61853.ENSNLEP00000018571	0.826	GRB2-related adaptor protein 2
10	61853.ENSNLEP00000002053	0.815	Cbl proto-oncogene C, E3 ubiquitin protein ligase
11	61853.ENSNLEP00000020533	0.795	Fibroblast growth factor receptor 2
12	61853.ENSNLEP00000010109	0.794	HRas proto-oncogene, GTPase
13	61853.ENSNLEP00000006071	0.790	Protein tyrosine phosphatase, non-receptor type 6
14	61853.ENSNLEP00000019976	0.790	SOS Ras/Rac guanine nucleotide exchange factor 1
15	61853.ENSNLEP00000016465	0.779	RAS p21 protein activator (GTPase activating protein) 1
16	61853.ENSNLEP00000016808	0.772	Hepatocyte growth factor-regulated tyrosine kinase substrate
17	61853.ENSNLEP00000000072	0.769	Uncharacterized protein
18	61853.ENSNLEP00000010419	0.749	Receptor protein-tyrosine kinase
19	61853.ENSNLEP00000001285	0.745	Receptor protein-tyrosine kinase
20	61853.ENSNLEP00000024052	0.744	B-Raf proto-oncogene, serine/threonine kinase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.395	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048519	0.997	negative regulation of biological process
GO:0080090	0.996	regulation of primary metabolic process
GO:0060255	0.996	regulation of macromolecule metabolic process
GO:0051171	0.996	regulation of nitrogen compound metabolic process
GO:0031323	0.996	regulation of cellular metabolic process
GO:0009968	0.994	negative regulation of signal transduction
GO:0050896	0.990	response to stimulus
GO:0043408	0.990	regulation of MAPK cascade
GO:0050790	0.987	regulation of catalytic activity
GO:0001932	0.986	regulation of protein phosphorylation
GO:0051338	0.983	regulation of transferase activity
GO:0031400	0.979	negative regulation of protein modification process
GO:0042326	0.978	negative regulation of phosphorylation
GO:0048518	0.974	positive regulation of biological process
GO:0050793	0.970	regulation of developmental process
GO:0001933	0.970	negative regulation of protein phosphorylation
GO:0043549	0.963	regulation of kinase activity
GO:0007165	0.958	signal transduction
GO:1902532	0.956	negative regulation of intracellular signal transduction
GO:0043409	0.951	negative regulation of MAPK cascade
GO:0071900	0.951	regulation of protein serine/threonine kinase activity
GO:0070372	0.950	regulation of ERK1 and ERK2 cascade
GO:0006469	0.950	negative regulation of protein kinase activity
GO:0048856	0.945	anatomical structure development
GO:0090287	0.942	regulation of cellular response to growth factor stimulus
GO:0043405	0.935	regulation of MAP kinase activity
GO:0032501	0.931	multicellular organismal process
GO:0071901	0.930	negative regulation of protein serine/threonine kinase activity
GO:0007275	0.918	multicellular organism development
GO:0070373	0.898	negative regulation of ERK1 and ERK2 cascade
GO:0009719	0.894	response to endogenous stimulus
GO:0048522	0.887	positive regulation of cellular process
GO:0051239	0.883	regulation of multicellular organismal process
GO:0040036	0.883	regulation of fibroblast growth factor receptor signaling pathway
GO:0043407	0.881	negative regulation of MAP kinase activity
GO:0048731	0.858	system development
GO:0071495	0.854	cellular response to endogenous stimulus
GO:0090288	0.828	negative regulation of cellular response to growth factor stimulus
GO:0009653	0.824	anatomical structure morphogenesis
GO:0042221	0.751	response to chemical
GO:0009893	0.738	positive regulation of metabolic process
GO:0071345	0.738	cellular response to cytokine stimulus
GO:0070848	0.734	response to growth factor
GO:0010604	0.699	positive regulation of macromolecule metabolic process
GO:0051173	0.697	positive regulation of nitrogen compound metabolic process
GO:0042127	0.676	regulation of cell population proliferation
GO:0031325	0.672	positive regulation of cellular metabolic process
GO:0048584	0.664	positive regulation of response to stimulus
GO:0051247	0.640	positive regulation of protein metabolic process
GO:0009967	0.613	positive regulation of signal transduction
GO:0010468	0.569	regulation of gene expression
GO:0035295	0.566	tube development
GO:0010941	0.564	regulation of cell death
GO:0071363	0.562	cellular response to growth factor stimulus
GO:0007166	0.559	cell surface receptor signaling pathway
GO:0051093	0.535	negative regulation of developmental process
GO:0043067	0.493	regulation of programmed cell death
GO:0045937	0.459	positive regulation of phosphate metabolic process
GO:0031401	0.455	positive regulation of protein modification process
GO:0019219	0.452	regulation of nucleobase-containing compound metabolic process
GO:0051241	0.450	negative regulation of multicellular organismal process
GO:0060548	0.443	negative regulation of cell death
GO:0009889	0.441	regulation of biosynthetic process
GO:0051252	0.441	regulation of RNA metabolic process
GO:0007167	0.432	enzyme-linked receptor protein signaling pathway
GO:0008152	0.412	metabolic process
GO:0010556	0.403	regulation of macromolecule biosynthetic process
GO:0031326	0.396	regulation of cellular biosynthetic process
GO:0048513	0.384	animal organ development
GO:1902533	0.378	positive regulation of intracellular signal transduction
GO:2000026	0.374	regulation of multicellular organismal development
GO:0044237	0.363	cellular metabolic process
GO:0006355	0.347	regulation of DNA-templated transcription
GO:0042327	0.346	positive regulation of phosphorylation
GO:0043069	0.330	negative regulation of programmed cell death
GO:0042981	0.329	regulation of apoptotic process
GO:0001934	0.324	positive regulation of protein phosphorylation
GO:0071840	0.320	cellular component organization or biogenesis
GO:0045595	0.313	regulation of cell differentiation
GO:0007169	0.312	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0043066	0.300	negative regulation of apoptotic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0043229	1.000	intracellular organelle
GO:0005829	1.000	cytosol
GO:0043232	0.990	intracellular non-membrane-bounded organelle
GO:0043231	0.965	intracellular membrane-bounded organelle
GO:0071944	0.957	cell periphery
GO:0005886	0.948	plasma membrane
GO:0005634	0.923	nucleus
GO:0005856	0.780	cytoskeleton
GO:0031981	0.375	nuclear lumen
GO:0099080	0.302	supramolecular complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]