StarFunc result for job id O43598

User Input

>input (174 residues)
MAAAMVPGRSESWERGEPGRPALYFCGSIRGGREDRTLYERIVSRLRRFGTVLTEHVAAA
ELGARGEEAAGGDRLIHEQDLEWLQQADVVVAEVTQPSLGVGYELGRAVAFNKRILCLFR
PQSGRVLSAMIRGAADGSRFQVWDYEEGEVEALLDRYFEADPPGQVAASPDPTT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43598	1.000	1.000	1.712E-36	174	1.000	1.000	O43598.pdb.gz	DNPH1_HUMAN 2'-deoxynucleoside 5'-phosphate N-hydrolase 1 OS=Homo sapiens OX=9606 GN=DNPH1 PE=1 SV=1
2	AFDB:O35820	0.841	0.896	1.875E-26	163	0.718	0.767	O35820.pdb.gz	DNPH1_RAT 2'-deoxynucleoside 5'-phosphate N-hydrolase 1 OS=Rattus norvegicus OX=10116 GN=Dnph1 PE=1 SV=1
3	PDB:2khzA	0.745	0.791	3.182E-19	163	0.713	0.761	2khzA.pdb.gz
4	AFDB:Q68FQ5	0.457	0.138	1.702E-4	727	0.132	0.032	Q68FQ5.pdb.gz	Q68FQ5_RAT Mitochondrial translational initiation factor 2 OS=Rattus norvegicus OX=10116 GN=Mtif2 PE=1 SV=1
5	AFDB:Q9Y7P9	0.423	0.357	1.937E-4	211	0.115	0.095	Q9Y7P9.pdb.gz	YQ65_SCHPO Uncharacterized protein C191.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC191.05c PE=3 SV=1
6	AFDB:P0A705	0.467	0.117	3.246E-4	890	0.144	0.028	P0A705.pdb.gz	IF2_ECOLI Translation initiation factor IF-2 OS=Escherichia coli (strain K12) OX=83333 GN=infB PE=1 SV=1
7	PDB:7anwA	0.501	0.159	4.427E-4	645	0.098	0.026	7anwA.pdb.gz	Structural basis for SARM1 inhibition and activation under energetic stress.
8	AFDB:I1GTC2	0.492	0.398	5.805E-4	224	0.167	0.129	I1GTC2.pdb.gz	BDTIR_BRADI Probable 2' cyclic ADP-D-ribose synthase BdTIR OS=Brachypodium distachyon OX=15368 GN=BRADI_1g24377v3 PE=1 SV=1
9	AFDB:O18334	0.451	0.392	6.605E-4	208	0.161	0.135	O18334.pdb.gz	RAB6_DROME Ras-related protein Rab6 OS=Drosophila melanogaster OX=7227 GN=Rab6 PE=1 SV=1
10	AFDB:Q8I3U2	0.444	0.067	6.605E-4	1610	0.126	0.014	Q8I3U2.pdb.gz	Q8I3U2_PLAF7 Sporozoite surface antigen MB2 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0516600 PE=3 SV=1
11	AFDB:Q7Z6P3	0.399	0.098	7.515E-4	1021	0.218	0.037	Q7Z6P3.pdb.gz	RAB44_HUMAN Ras-related protein Rab-44 OS=Homo sapiens OX=9606 GN=RAB44 PE=1 SV=4
12	PDB:3jcjf	0.419	0.168	7.916E-4	509	0.121	0.041	3jcjf.pdb.gz	Structures of ribosome-bound initiation factor 2 reveal the mechanism of subunit association.
13	AFDB:Q8CB87	0.408	0.095	9.122E-4	973	0.190	0.034	Q8CB87.pdb.gz	RAB44_MOUSE Ras-related protein Rab-44 OS=Mus musculus OX=10090 GN=Rab44 PE=1 SV=2
14	PDB:1puiA	0.476	0.488	1.510E-3	169	0.132	0.136	1puiA.pdb.gz
15	PDB:7po27	0.457	0.170	2.531E-3	571	0.132	0.040	7po27.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
16	PDB:7mqaSI	0.441	0.118	4.526E-3	803	0.144	0.031	7mqaSI.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:7sd0B	0.380	0.380	5.150E-3	174	0.103	0.103	7sd0B.pdb.gz	Structural basis for SHOC2 modulation of RAS signalling.
18	PDB:1sulB	0.536	0.485	5.493E-3	195	0.109	0.097	1sulB.pdb.gz
19	PDB:1zbdA	0.405	0.400	6.250E-3	177	0.138	0.136	1zbdA.pdb.gz	Structural basis of Rab effector specificity: crystal structure of the small G protein Rab3A complexed with the effector domain of rabphilin-3A.
20	PDB:1pswA	0.431	0.257	6.667E-3	331	0.144	0.076	1pswA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43598	1.74e-124	349	174	1.000	1.000	DNPH1_HUMAN 2'-deoxynucleoside 5'-phosphate N-hydrolase 1 OS=Homo sapiens OX=9606 GN=DNPH1 PE=1 SV=1
2	O35820	1.96e-85	250	163	0.718	0.767	DNPH1_RAT 2'-deoxynucleoside 5'-phosphate N-hydrolase 1 OS=Rattus norvegicus OX=10116 GN=Dnph1 PE=1 SV=1
3	Q9H3S4	4.4	30.0	243	0.109	0.078	TPK1_HUMAN Thiamin pyrophosphokinase 1 OS=Homo sapiens OX=9606 GN=TPK1 PE=1 SV=1
4	P43034	6.4	29.6	410	0.103	0.044	LIS1_HUMAN Platelet-activating factor acetylhydrolase IB subunit beta OS=Homo sapiens OX=9606 GN=PAFAH1B1 PE=1 SV=2
5	P63004	6.4	29.6	410	0.103	0.044	LIS1_RAT Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus OX=10116 GN=Pafah1b1 PE=1 SV=2
6	P63005	6.4	29.6	410	0.103	0.044	LIS1_MOUSE Platelet-activating factor acetylhydrolase IB subunit beta OS=Mus musculus OX=10090 GN=Pafah1b1 PE=1 SV=2
7	P43033	6.6	29.6	410	0.103	0.044	LIS1_BOVIN Platelet-activating factor acetylhydrolase IB subunit beta OS=Bos taurus OX=9913 GN=PAFAH1B1 PE=1 SV=2
8	G3G8W7	8.5	28.9	249	0.121	0.084	G3G8W7_9ALPH Tegument protein VP22 OS=Suid alphaherpesvirus 1 OX=10345 GN=UL49 PE=3 SV=1
9	Q8QXN7	8.5	28.9	249	0.121	0.084	Q8QXN7_SUHVK Tegument protein VP22 OS=Suid herpesvirus 1 (strain Kaplan) OX=33703 GN=UL49 PE=3 SV=1
10	A0A1D8PK53	9.7	29.3	4161	0.121	0.005	A0A1D8PK53_CANAL Dynein heavy chain, cytoplasmic OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DYN1 PE=4 SV=1
11	Q9R0M5	9.8	28.9	243	0.069	0.049	TPK1_MOUSE Thiamin pyrophosphokinase 1 OS=Mus musculus OX=10090 GN=Tpk1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05014 Nuc_deoxyrib_tr	3.9e-13	61.0	Nucleoside 2-deoxyribosyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000230431

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000306070	0.716	Nucleoside diphosphate-linked moiety X motif 6
2	9606.ENSP00000247153	0.692	Properdin
3	9606.ENSP00000441497	0.662	Serpin B11
4	9606.ENSP00000269491	0.650	Serpin B12
5	9606.ENSP00000363384	0.633	Zinc finger protein 593
6	9606.ENSP00000290650	0.618	E3 ubiquitin-protein ligase UBR1
7	9606.ENSP00000429216	0.568	TMF-regulated nuclear protein 1
8	9606.ENSP00000343445	0.543	Serpin B4
9	9606.ENSP00000370115	0.505	Leukocyte elastase inhibitor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0070694	1.000	deoxyribonucleoside 5'-monophosphate N-glycosidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:1901361	0.987	organic cyclic compound catabolic process
GO:0046700	0.987	heterocycle catabolic process
GO:0019439	0.987	aromatic compound catabolic process
GO:0044270	0.987	cellular nitrogen compound catabolic process
GO:0046434	0.987	organophosphate catabolic process
GO:0006753	0.987	nucleoside phosphate metabolic process
GO:0009166	0.967	nucleotide catabolic process
GO:1901565	0.940	organonitrogen compound catabolic process
GO:0072523	0.912	purine-containing compound catabolic process
GO:0009123	0.907	nucleoside monophosphate metabolic process
GO:0006195	0.899	purine nucleotide catabolic process
GO:0009162	0.868	deoxyribonucleoside monophosphate metabolic process
GO:0065007	0.808	biological regulation
GO:0050789	0.768	regulation of biological process
GO:0050794	0.747	regulation of cellular process
GO:0032502	0.366	developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.999	cytoplasm
GO:0005576	0.990	extracellular region
GO:0031982	0.972	vesicle
GO:0005615	0.970	extracellular space
GO:0005829	0.931	cytosol
GO:1903561	0.846	extracellular vesicle
GO:0070062	0.837	extracellular exosome
GO:0070013	0.403	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.2.2.-	1.000	Hydrolyzing N-glycosyl compounds.

[back to server]