StarFunc result for job id O43609

User Input

>input (319 residues)
MDPQNQHGSGSSLVVIQQPSLDSRQRLDYEREIQPTAILSLDQIKAIRGSNEYTEGPSVV
KRPAPRTAPRQEKHERTHEIIPINVNNNYEHRHTSHLGHAVLPSNARGPILSRSTSTGSA
ASSGSNSSASSEQGLLGRSPPTRPVPGHRSERAIRTQPKQLIVDDLKGSLKEDLTQHKFI
CEQCGKCKCGECTAPRTLPSCLACNRQCLCSAESMVEYGTCMCLVKGIFYHCSNDDEGDS
YSDNPCSCSQSHCCSRYLCMGAMSLFLPCLLCYPPAKGCLKLCRRCYDWIHRPGCRCKNS
NTVYCKLESCPSRGQGKPS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43609	0.999	0.999	4.363E-53	319	1.000	1.000	O43609.pdb.gz	SPY1_HUMAN Protein sprouty homolog 1 OS=Homo sapiens OX=9606 GN=SPRY1 PE=1 SV=2
2	AFDB:B5DFH3	0.484	0.493	6.745E-43	313	0.831	0.847	B5DFH3.pdb.gz	B5DFH3_RAT Sprouty RTK signaling antagonist 1 OS=Rattus norvegicus OX=10116 GN=Spry1 PE=2 SV=1
3	AFDB:F1QU39	0.429	0.451	4.400E-22	301	0.395	0.419	F1QU39.pdb.gz	F1QU39_DANRE Protein sprouty homolog 2 isoform X1 OS=Danio rerio OX=7955 GN=wu:fk66h11 PE=4 SV=1
4	AFDB:O44783	0.373	0.209	1.856E-11	589	0.282	0.153	O44783.pdb.gz	SPY_DROME Protein sprouty OS=Drosophila melanogaster OX=7227 GN=sty PE=1 SV=2
5	AFDB:H0ZLY1	0.093	0.059	1.215	621	0.160	0.082	H0ZLY1.pdb.gz	H0ZLY1_TAEGU Estrogen receptor OS=Taeniopygia guttata OX=59729 GN=ESR1 PE=3 SV=2
6	AFDB:Q57XU7	0.084	0.049	1.377	788	0.160	0.065	Q57XU7.pdb.gz	Q57XU7_TRYB2 Ubiquitin-like domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.21H15.30 PE=4 SV=1
7	AFDB:Q90435	0.104	0.102	1.884	331	0.141	0.136	Q90435.pdb.gz	PO4F3_DANRE POU domain, class 4, transcription factor 3 OS=Danio rerio OX=7955 GN=pou4f3 PE=2 SV=2
8	AFDB:Q6H543	0.104	0.108	2.579	300	0.141	0.150	Q6H543.pdb.gz	IAA7_ORYSJ Auxin-responsive protein IAA7 OS=Oryza sativa subsp. japonica OX=39947 GN=IAA7 PE=2 SV=1
9	PDB:3rj1O	0.109	0.297	4.121	94	0.031	0.106	3rj1O.pdb.gz	Architecture of the Mediator head module.
10	PDB:7e1vM	0.080	0.071	4.121	378	0.053	0.045	7e1vM.pdb.gz	Structure of Mycobacterium tuberculosis cytochrome bcc in complex with Q203 and TB47, two anti-TB drug candidates.
11	AFDB:O08856	0.098	0.059	4.535	602	0.135	0.071	O08856.pdb.gz	ELL_MOUSE RNA polymerase II elongation factor ELL OS=Mus musculus OX=10090 GN=Ell PE=2 SV=2
12	AFDB:Q5YGP7	0.111	0.071	4.535	568	0.082	0.046	Q5YGP7.pdb.gz	PLET2_ARATH AP2-like ethylene-responsive transcription factor PLT2 OS=Arabidopsis thaliana OX=3702 GN=PLT2 PE=2 SV=1
13	PDB:7b93V	0.093	0.202	4.672	115	0.028	0.078	7b93V.pdb.gz	Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.
14	PDB:7acoB	0.086	0.142	5.297	180	0.025	0.044	7acoB.pdb.gz
15	PDB:4aciB	0.094	0.145	8.749	177	0.028	0.051	4aciB.pdb.gz	Crystal and Solution Studies Reveal that the Transcriptional Regulator Acnr of Corynebacterium Glutamicum is Regulated by Citrate:Mg2+ Binding to a Non-Canonical Pocket.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43609	0.0	652	319	1.000	1.000	SPY1_HUMAN Protein sprouty homolog 1 OS=Homo sapiens OX=9606 GN=SPRY1 PE=1 SV=2
2	Q9QXV9	2.82e-163	459	313	0.834	0.850	SPY1_MOUSE Protein sprouty homolog 1 OS=Mus musculus OX=10090 GN=Spry1 PE=1 SV=1
3	B5DFH3	1.73e-162	457	313	0.831	0.847	B5DFH3_RAT Sprouty RTK signaling antagonist 1 OS=Rattus norvegicus OX=10116 GN=Spry1 PE=2 SV=1
4	D6RHD2	4.78e-151	424	209	0.655	1.000	D6RHD2_HUMAN Sprouty RTK signaling antagonist 1 (Fragment) OS=Homo sapiens OX=9606 GN=SPRY1 PE=1 SV=1
5	O43597	5.27e-96	288	315	0.552	0.559	SPY2_HUMAN Protein sprouty homolog 2 OS=Homo sapiens OX=9606 GN=SPRY2 PE=1 SV=1
6	Q7Z783	7.31e-90	274	353	0.524	0.473	Q7Z783_HUMAN SPRY2 protein OS=Homo sapiens OX=9606 PE=1 SV=1
7	Q9QXV8	1.84e-89	271	315	0.536	0.543	SPY2_MOUSE Protein sprouty homolog 2 OS=Mus musculus OX=10090 GN=Spry2 PE=1 SV=1
8	Q9C004	6.05e-72	226	299	0.417	0.445	SPY4_HUMAN Protein sprouty homolog 4 OS=Homo sapiens OX=9606 GN=SPRY4 PE=1 SV=2
9	Q9WTP2	3.76e-71	224	300	0.426	0.453	SPY4_MOUSE Protein sprouty homolog 4 OS=Mus musculus OX=10090 GN=Spry4 PE=1 SV=1
10	Q90XH4	1.58e-67	215	310	0.401	0.413	Q90XH4_DANRE Sprouty4 OS=Danio rerio OX=7955 GN=sprouty4 PE=2 SV=1
11	Q4VBS7	5.81e-65	208	301	0.423	0.449	Q4VBS7_DANRE Protein sprouty homolog 2 OS=Danio rerio OX=7955 GN=zgc:110440 PE=2 SV=1
12	F1QU39	7.69e-65	208	301	0.423	0.449	F1QU39_DANRE Protein sprouty homolog 2 isoform X1 OS=Danio rerio OX=7955 GN=wu:fk66h11 PE=4 SV=1
13	O43610	7.26e-55	182	288	0.370	0.410	SPY3_HUMAN Protein sprouty homolog 3 OS=Homo sapiens OX=9606 GN=SPRY3 PE=1 SV=2
14	Q3UUD2	1.18e-52	176	288	0.364	0.403	SPRY3_MOUSE Protein sprouty homolog 3 OS=Mus musculus OX=10090 GN=Spry3 PE=1 SV=1
15	O44783	1.67e-33	131	589	0.179	0.097	SPY_DROME Protein sprouty OS=Drosophila melanogaster OX=7227 GN=sty PE=1 SV=2
16	F0JAK5	2.65e-08	57.0	404	0.078	0.062	F0JAK5_DROME LD31195p OS=Drosophila melanogaster OX=7227 GN=Spred PE=2 SV=1
17	Q7K0G4	3.00e-08	57.0	426	0.078	0.059	Q7K0G4_DROME SD10629p OS=Drosophila melanogaster OX=7227 GN=Spred PE=2 SV=1
18	A0A0B4KG11	3.03e-08	57.0	519	0.078	0.048	A0A0B4KG11_DROME Sprouty-related protein with EVH-1 domain, isoform C OS=Drosophila melanogaster OX=7227 GN=Spred PE=4 SV=1
19	Q924S8	1.26e-07	55.1	444	0.119	0.086	SPRE1_MOUSE Sprouty-related, EVH1 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Spred1 PE=1 SV=1
20	Q7Z699	1.32e-07	55.1	444	0.085	0.061	SPRE1_HUMAN Sprouty-related, EVH1 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SPRED1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05210 Sprouty	2.2e-30	116.8	Sprouty protein (Spry)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000481675

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264033	0.998	E3 ubiquitin-protein ligase CBL
2	9606.ENSP00000376345	0.987	Growth factor receptor-bound protein 2
3	9606.ENSP00000366306	0.947	Protein sprouty homolog 2
4	9606.ENSP00000274376	0.946	Ras GTPase-activating protein 1
5	9606.ENSP00000407586	0.943	GTPase HRas
6	9606.ENSP00000344967	0.925	Protein sprouty homolog 4
7	9606.ENSP00000302978	0.923	Protein sprouty homolog 3
8	9606.ENSP00000334928	0.910	Receptor-type tyrosine-protein phosphatase beta
9	9606.ENSP00000383003	0.840	Peptidyl-prolyl cis-trans isomerase FKBP1A
10	9606.ENSP00000275493	0.810	Epidermal growth factor receptor
11	9606.ENSP00000380921	0.779	SH3 domain-containing kinase-binding protein 1
12	9606.ENSP00000265171	0.774	Pro-epidermal growth factor
13	9606.ENSP00000339191	0.727	Caveolin-1
14	9606.ENSP00000307863	0.679	Splicing factor U2AF 65 kDa subunit
15	9606.ENSP00000331201	0.670	Hepatocyte growth factor-regulated tyrosine kinase substrate
16	9606.ENSP00000251849	0.656	RAF proto-oncogene serine/threonine-protein kinase
17	9606.ENSP00000264664	0.656	Fibroblast growth factor 10
18	9606.ENSP00000379097	0.653	Amphiregulin
19	9606.ENSP00000481045	0.653	Dual specificity testis-specific protein kinase 1
20	9606.ENSP00000300452	0.651	Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.366	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0048583	0.989	regulation of response to stimulus
GO:0023051	0.985	regulation of signaling
GO:0010646	0.985	regulation of cell communication
GO:0009966	0.984	regulation of signal transduction
GO:0048519	0.974	negative regulation of biological process
GO:0009987	0.972	cellular process
GO:0048523	0.955	negative regulation of cellular process
GO:0050896	0.875	response to stimulus
GO:0090287	0.865	regulation of cellular response to growth factor stimulus
GO:0090288	0.861	negative regulation of cellular response to growth factor stimulus
GO:0032502	0.825	developmental process
GO:0048856	0.824	anatomical structure development
GO:0007275	0.806	multicellular organism development
GO:0051716	0.753	cellular response to stimulus
GO:0019222	0.743	regulation of metabolic process
GO:1902531	0.740	regulation of intracellular signal transduction
GO:0009968	0.735	negative regulation of signal transduction
GO:0060255	0.702	regulation of macromolecule metabolic process
GO:0048731	0.689	system development
GO:1902532	0.685	negative regulation of intracellular signal transduction
GO:0007165	0.677	signal transduction
GO:0048518	0.642	positive regulation of biological process
GO:0031323	0.608	regulation of cellular metabolic process
GO:0080090	0.593	regulation of primary metabolic process
GO:0051171	0.592	regulation of nitrogen compound metabolic process
GO:0009653	0.570	anatomical structure morphogenesis
GO:0040036	0.566	regulation of fibroblast growth factor receptor signaling pathway
GO:0048522	0.468	positive regulation of cellular process
GO:0031399	0.463	regulation of protein modification process
GO:0065009	0.446	regulation of molecular function
GO:0043408	0.438	regulation of MAPK cascade
GO:0019220	0.425	regulation of phosphate metabolic process
GO:0001932	0.357	regulation of protein phosphorylation
GO:0051239	0.344	regulation of multicellular organismal process
GO:0050790	0.315	regulation of catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043229	0.997	intracellular organelle
GO:0012505	0.995	endomembrane system
GO:0005654	0.992	nucleoplasm
GO:0005886	0.980	plasma membrane
GO:0005794	0.660	Golgi apparatus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]