StarFunc result for job id O43623

User Input

>input (268 residues)
MPRSFLVKKHFNASKKPNYSELDTHTVIISPYLYESYSMPVIPQPEILSSGAYSPITVWT
TAAPFHAQLPNGLSPLSGYSSSLGRVSPPPPSDTSSKDHSGSESPISDEEERLQSKLSDP
HAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYVSLGALKMHIRT
HTLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSNLRAHLQTHSDVKK
YQCKNCSKTFSRMSLLHKHEESGCCVAH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P19382	0.533	0.550	2.611E-31	259	0.709	0.734	P19382.pdb.gz	SNAI1_XENLA Protein snail homolog Sna OS=Xenopus laevis OX=8355 GN=snai1 PE=1 SV=1
2	AFDB:Q3KNW1	0.518	0.476	2.500E-26	292	0.549	0.503	Q3KNW1.pdb.gz	SNAI3_HUMAN Zinc finger protein SNAI3 OS=Homo sapiens OX=9606 GN=SNAI3 PE=2 SV=1
3	AFDB:P25932	0.488	0.290	5.582E-23	470	0.493	0.281	P25932.pdb.gz	ESCA_DROME Protein escargot OS=Drosophila melanogaster OX=7227 GN=esg PE=1 SV=2
4	AFDB:Q90414	0.437	0.453	2.821E-22	257	0.526	0.549	Q90414.pdb.gz
5	AFDB:P08044	0.477	0.334	4.440E-22	390	0.444	0.305	P08044.pdb.gz	SNAI_DROME Protein snail OS=Drosophila melanogaster OX=7227 GN=sna PE=1 SV=2
6	AFDB:Q8SXL3	0.494	0.253	5.209E-21	548	0.481	0.235	Q8SXL3.pdb.gz	Q8SXL3_DROME RE10012p OS=Drosophila melanogaster OX=7227 GN=wor PE=2 SV=1
7	AFDB:A4IGB7	0.511	0.445	6.958E-20	312	0.407	0.349	A4IGB7.pdb.gz
8	AFDB:Q24140	0.316	0.137	6.927E-18	664	0.354	0.143	Q24140.pdb.gz	Q24140_DROME Neuron specific zinc finger transcription factor OS=Drosophila melanogaster OX=7227 GN=scrt PE=2 SV=1
9	AFDB:G5ECN8	0.398	0.395	7.886E-18	270	0.310	0.307	G5ECN8.pdb.gz	G5ECN8_CAEEL C2H2-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ces-1 PE=1 SV=1
10	AFDB:F1NKI2	0.405	0.162	1.945E-15	749	0.261	0.093	F1NKI2.pdb.gz
11	PDB:3w5kB	0.174	0.336	1.473E-11	110	0.340	0.827	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6ydhA	0.064	0.214	8.288E-1	62	0.034	0.145	6ydhA.pdb.gz
13	PDB:7ad8D	0.065	0.062	2.191	280	0.063	0.061	7ad8D.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
14	PDB:7uhyA	0.080	0.037	2.839	771	0.097	0.034	7uhyA.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
15	PDB:7uhyC	0.077	0.039	2.839	578	0.063	0.029	7uhyC.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
16	PDB:6ff79	0.096	0.064	3.679	432	0.086	0.053	6ff79.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
17	PDB:4kblA	0.075	0.054	4.468	395	0.075	0.051	4kblA.pdb.gz	Structure of HHARI, a RING-IBR-RING Ubiquitin Ligase: Autoinhibition of an Ariadne-Family E3 and Insights into Ligation Mechanism.
18	PDB:6qx91C	0.080	0.300	5.087	50	0.026	0.140	6qx91C.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
19	PDB:7ktrE	0.116	0.205	5.427	124	0.056	0.121	7ktrE.pdb.gz	Structure of the human SAGA coactivator complex.
20	PDB:7uhyD	0.074	0.069	5.790	288	0.086	0.080	7uhyD.pdb.gz	Structure of the nutrient-sensing hub GATOR2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O08954	0.0	525	268	0.948	0.948	SNAI2_RAT Zinc finger protein SNAI2 OS=Rattus norvegicus OX=10116 GN=Snai2 PE=2 SV=2
2	O43623	0.0	553	268	1.000	1.000	SNAI2_HUMAN Zinc finger protein SNAI2 OS=Homo sapiens OX=9606 GN=SNAI2 PE=1 SV=1
3	P97469	0.0	507	269	0.955	0.952	SNAI2_MOUSE Zinc finger protein SNAI2 OS=Mus musculus OX=10090 GN=Snai2 PE=1 SV=1
4	Q91051	1.13e-178	494	268	0.933	0.933	Q91051_9GALL Slug protein OS=Gallus sp. OX=9036 GN=Slug PE=2 SV=1
5	Q91924	3.66e-177	490	266	0.892	0.898	SNAI2_XENLA Zinc finger protein SNAI2 OS=Xenopus laevis OX=8355 GN=snai2 PE=1 SV=1
6	P19382	5.87e-127	362	259	0.716	0.741	SNAI1_XENLA Protein snail homolog Sna OS=Xenopus laevis OX=8355 GN=snai1 PE=1 SV=1
7	O95863	1.08e-83	253	264	0.545	0.553	SNAI1_HUMAN Zinc finger protein SNAI1 OS=Homo sapiens OX=9606 GN=SNAI1 PE=1 SV=2
8	B3DH44	9.15e-82	248	256	0.549	0.574	B3DH44_DANRE LOC792194 protein OS=Danio rerio OX=7955 GN=LOC792194 PE=2 SV=1
9	Q6AY35	1.98e-81	247	264	0.534	0.542	Q6AY35_RAT Snail homolog 1 (Drosophila) OS=Rattus norvegicus OX=10116 GN=Snai1 PE=2 SV=1
10	Q02085	8.24e-81	246	264	0.534	0.542	SNAI1_MOUSE Zinc finger protein SNAI1 OS=Mus musculus OX=10090 GN=Snai1 PE=1 SV=1
11	Q3KNW1	1.31e-80	246	292	0.549	0.503	SNAI3_HUMAN Zinc finger protein SNAI3 OS=Homo sapiens OX=9606 GN=SNAI3 PE=2 SV=1
12	Q9QY31	1.27e-75	233	287	0.511	0.477	SNAI3_MOUSE Zinc finger protein SNAI3 OS=Mus musculus OX=10090 GN=Snai3 PE=2 SV=1
13	P25932	5.85e-73	232	470	0.410	0.234	ESCA_DROME Protein escargot OS=Drosophila melanogaster OX=7227 GN=esg PE=1 SV=2
14	Q9U7P8	1.12e-72	233	548	0.403	0.197	Q9U7P8_DROME Zinc finger protein Worniu OS=Drosophila melanogaster OX=7227 GN=wor PE=2 SV=1
15	Q9VJP2	1.16e-72	233	548	0.403	0.197	Q9VJP2_DROME Worniu OS=Drosophila melanogaster OX=7227 GN=wor PE=4 SV=1
16	Q8SXL3	1.19e-72	233	548	0.403	0.197	Q8SXL3_DROME RE10012p OS=Drosophila melanogaster OX=7227 GN=wor PE=2 SV=1
17	Q90274	1.92e-72	224	260	0.515	0.531	Q90274_DANRE Sna-1 protein OS=Danio rerio OX=7955 GN=sna1 PE=2 SV=1
18	P08044	2.30e-65	210	390	0.366	0.251	SNAI_DROME Protein snail OS=Drosophila melanogaster OX=7227 GN=sna PE=1 SV=2
19	Q6YI50	4.62e-54	179	312	0.336	0.288	Q6YI50_DANRE Scratch-a transcription factor OS=Danio rerio OX=7955 GN=scrta PE=2 SV=1
20	Q8BTH6	2.52e-51	172	311	0.306	0.264	SCRT2_MOUSE Transcriptional repressor scratch 2 OS=Mus musculus OX=10090 GN=Scrt2 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15961 DUF4764	9.2e+02	9.8	Domain of unknown function (DUF4764)
2	PF05129 Elf1	31	16.0	Transcription elongation factor Elf1 like
3	PF04606 Ogr_Delta	33	15.8	Ogr/Delta-like zinc finger
4	PF01428 zf-AN1	74	14.9	AN1-like Zinc finger
5	PF02892 zf-BED	0.99	20.8	BED zinc finger
6	PF00096 zf-C2H2	1.9e-24	95.8	Zinc finger, C2H2 type
7	PF12756 zf-C2H2_2	33	16.2	C2H2 type zinc-finger (2 copies)
8	PF13894 zf-C2H2_4	2.3e-17	73.2	C2H2-type zinc finger
9	PF13912 zf-C2H2_6	7.3e-07	40.3	C2H2-type zinc finger
10	PF12171 zf-C2H2_jaz	1.2e-11	55.7	Zinc-finger double-stranded RNA-binding
11	PF13913 zf-C2HC_2	0.15	23.2	zinc-finger of a C2HC-type
12	PF16278 zf-C2HE	0.2	23.5	C2HE / C2H2 / C2HC zinc-binding finger
13	PF05605 zf-Di19	0.00013	33.5	Drought induced 19 protein (Di19), zinc-binding
14	PF13465 zf-H2C2_2	3.3e-15	66.9	Zinc-finger double domain
15	PF13909 zf-H2C2_5	2e+02	13.2	C2H2-type zinc-finger domain
16	PF12874 zf-met	0.00017	33.1	Zinc-finger of C2H2 type
17	PF17032 zinc_ribbon_15	25	17.0	zinc-ribbon family
18	PF09723 Zn-ribbon_8	57	15.3	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010355318.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010362667.1	0.925	Histone demethylase that demethylates both 'Lys-4' (H3K4me) and 'Lys-9' (H3K9me) of histone H3, thereby acting as a coactivator or a corepressor, depending on the context. Acts by oxidizing the substrate by FAD to generate the corresponding imine that is subsequently hydrolyzed. Acts as a corepressor by mediating demethylation of H3K4me, a specific tag for epigenetic transcriptional activation. Demethylates both mono- (H3K4me1) and di-methylated (H3K4me2) H3K4me
2	61622.XP_010352359.1	0.911	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes
3	61622.XP_010380663.1	0.911	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes
4	61622.XP_010353338.1	0.892	Cadherins are calcium-dependent cell adhesion proteins.
5	61622.XP_010373636.1	0.881	Belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family
6	61622.XP_010367481.1	0.800	Enhancer of zeste 2 polycomb repressive complex 2 subunit
7	61622.XP_010360689.1	0.790	Acts as a tumor suppressor in many tumor types
8	61622.XP_010355152.1	0.781	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes
9	61622.XP_010379251.1	0.774	Cadherins are calcium-dependent cell adhesion proteins.
10	61622.XP_010357283.1	0.767	KIT proto-oncogene receptor tyrosine kinase
11	61622.XP_010355396.1	0.762	Belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family
12	61622.XP_010355937.1	0.762	C-terminal-binding protein 2 isoform X1
13	61622.XP_010380194.1	0.729	SIN3 transcription regulator family member A
14	61622.XP_010353339.1	0.728	Cadherins are calcium-dependent cell adhesion proteins.
15	61622.XP_010357777.1	0.728	Cadherin-3-like
16	61622.XP_010357004.1	0.712	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 30 ESTs, and 92% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
17	61622.XP_010357050.1	0.710	Belongs to the MDM2/MDM4 family.
18	61622.XP_010387523.1	0.708	SRY-box 10
19	61622.XP_010386548.1	0.697	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4), and some other non-histone substrates. Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes.
20	61622.XP_010375105.1	0.696	REST corepressor 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003700	0.980	DNA-binding transcription factor activity
GO:1990837	0.953	sequence-specific double-stranded DNA binding
GO:0000981	0.939	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001217	0.910	DNA-binding transcription repressor activity
GO:0008134	0.909	transcription factor binding
GO:0001227	0.828	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0000976	0.718	transcription cis-regulatory region binding
GO:0051219	0.711	phosphoprotein binding
GO:0000977	0.644	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0048523	0.990	negative regulation of cellular process
GO:0048856	0.987	anatomical structure development
GO:0060485	0.981	mesenchyme development
GO:0001837	0.973	epithelial to mesenchymal transition
GO:0032501	0.972	multicellular organismal process
GO:0050896	0.960	response to stimulus
GO:0006355	0.946	regulation of DNA-templated transcription
GO:0048518	0.846	positive regulation of biological process
GO:0051172	0.825	negative regulation of nitrogen compound metabolic process
GO:0045934	0.822	negative regulation of nucleobase-containing compound metabolic process
GO:0009890	0.821	negative regulation of biosynthetic process
GO:0007275	0.809	multicellular organism development
GO:0048522	0.806	positive regulation of cellular process
GO:0031327	0.792	negative regulation of cellular biosynthetic process
GO:0006357	0.789	regulation of transcription by RNA polymerase II
GO:0009653	0.765	anatomical structure morphogenesis
GO:0048731	0.752	system development
GO:0051253	0.740	negative regulation of RNA metabolic process
GO:0051716	0.691	cellular response to stimulus
GO:1902679	0.678	negative regulation of RNA biosynthetic process
GO:0072359	0.671	circulatory system development
GO:1903507	0.671	negative regulation of nucleic acid-templated transcription
GO:0060317	0.662	cardiac epithelial to mesenchymal transition
GO:0045892	0.623	negative regulation of DNA-templated transcription
GO:0009893	0.603	positive regulation of metabolic process
GO:0010604	0.586	positive regulation of macromolecule metabolic process
GO:0048583	0.487	regulation of response to stimulus
GO:0010646	0.466	regulation of cell communication
GO:0009966	0.464	regulation of signal transduction
GO:0051173	0.457	positive regulation of nitrogen compound metabolic process
GO:0009719	0.430	response to endogenous stimulus
GO:0031325	0.427	positive regulation of cellular metabolic process
GO:0023052	0.425	signaling
GO:0007154	0.424	cell communication
GO:0007165	0.406	signal transduction
GO:0042127	0.394	regulation of cell population proliferation
GO:0050793	0.387	regulation of developmental process
GO:0051239	0.368	regulation of multicellular organismal process
GO:0070848	0.359	response to growth factor
GO:0000122	0.337	negative regulation of transcription by RNA polymerase II
GO:0007166	0.328	cell surface receptor signaling pathway
GO:0009891	0.325	positive regulation of biosynthetic process
GO:0031328	0.323	positive regulation of cellular biosynthetic process
GO:0010557	0.313	positive regulation of macromolecule biosynthetic process
GO:0045935	0.310	positive regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.992	nuclear lumen
GO:0005654	0.958	nucleoplasm
GO:0043232	0.866	intracellular non-membrane-bounded organelle
GO:0005737	0.819	cytoplasm
GO:0005694	0.336	chromosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]