StarFunc result for job id O43639

User Input

>input (380 residues)
MTEEVIVIAKWDYTAQQDQELDIKKNERLWLLDDSKTWWRVRNAANRTGYVPSNYVERKN
SLKKGSLVKNLKDTLGLGKTRRKTSARDASPTPSTDAEYPANGSGADRIYDLNIPAFVKF
AYVAEREDELSLVKGSRVTVMEKCSDGWWRGSYNGQIGWFPSNYVLEEVDEAAAESPSFL
SLRKGASLSNGQGSRVLHVVQTLYPFSSVTEEELNFEKGETMEVIEKPENDPEWWKCKNA
RGQVGLVPKNYVVVLSDGPALHPAHAPQISYTGPSSSGRFAGREWYYGNVTRHQAECALN
ERGVEGDFLIRDSESSPSDFSVSLKASGKNKHFKVQLVDNVYCIGQRRFHTMDELVEHYK
KAPIFTSEHGEKLYLVRALQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D4A3M8	0.841	0.841	3.924E-69	380	0.958	0.958	D4A3M8.pdb.gz	D4A3M8_RAT Cytoplasmic protein OS=Rattus norvegicus OX=10116 GN=Nck2 PE=1 SV=1
2	AFDB:A0A0S2Z4Y3	0.433	0.435	3.446E-55	377	0.689	0.695	A0A0S2Z4Y3.pdb.gz	A0A0S2Z4Y3_HUMAN NCK adaptor protein 1 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=NCK1 PE=2 SV=1
3	AFDB:Q95PX0	0.370	0.360	3.339E-39	397	0.429	0.411	Q95PX0.pdb.gz	Q95PX0_CAEEL NCK (Non-Catalytic region of tyrosine Kinase) adaptor protein family OS=Caenorhabditis elegans OX=6239 GN=nck-1 PE=1 SV=2
4	AFDB:Q9VPU1	0.270	0.188	8.461E-39	548	0.450	0.312	Q9VPU1.pdb.gz	Q9VPU1_DROME Dreadlocks, isoform B OS=Drosophila melanogaster OX=7227 GN=dock PE=1 SV=1
5	AFDB:A0A0S2Z4E4	0.288	0.449	2.433E-31	244	0.476	0.742	A0A0S2Z4E4.pdb.gz	A0A0S2Z4E4_HUMAN NCK adaptor protein 1 isoform 3 (Fragment) OS=Homo sapiens OX=9606 GN=NCK1 PE=1 SV=1
6	AFDB:Q9Z0R6	0.166	0.044	4.373E-18	1659	0.205	0.047	Q9Z0R6.pdb.gz	ITSN2_MOUSE Intersectin-2 OS=Mus musculus OX=10090 GN=Itsn2 PE=1 SV=2
7	AFDB:Q8INU2	0.167	0.088	8.429E-18	1014	0.189	0.071	Q8INU2.pdb.gz	Q8INU2_DROME Dynamin associated protein 160, isoform B OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
8	AFDB:M9ND00	0.253	0.091	2.383E-17	1190	0.226	0.072	M9ND00.pdb.gz	M9ND00_DROME Dynamin associated protein 160, isoform D OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
9	AFDB:Q9U2T9	0.203	0.091	3.308E-17	1085	0.182	0.064	Q9U2T9.pdb.gz	Q9U2T9_CAEEL Intersectin-1 OS=Caenorhabditis elegans OX=6239 GN=itsn-1 PE=1 SV=2
10	AFDB:Q9NZM3	0.164	0.045	5.125E-17	1697	0.213	0.048	Q9NZM3.pdb.gz	ITSN2_HUMAN Intersectin-2 OS=Homo sapiens OX=9606 GN=ITSN2 PE=1 SV=3
11	PDB:1k9aB	0.212	0.183	1.060E-11	441	0.132	0.113	1k9aB.pdb.gz
12	PDB:2h8hA	0.225	0.193	9.983E-11	445	0.132	0.112	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
13	PDB:1griA	0.218	0.381	1.464E-10	211	0.124	0.223	1griA.pdb.gz
14	PDB:4gwfA	0.243	0.187	4.094E-8	497	0.108	0.082	4gwfA.pdb.gz
15	PDB:2lqnA	0.145	0.180	6.698E-8	303	0.111	0.139	2lqnA.pdb.gz
16	PDB:5xzrA	0.243	0.180	2.489E-7	519	0.116	0.085	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
17	PDB:3ps5A	0.229	0.167	8.758E-7	529	0.100	0.072	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
18	PDB:2eyzA	0.157	0.193	1.032E-6	304	0.084	0.105	2eyzA.pdb.gz
19	PDB:1ka6A	0.225	0.745	2.344E-6	107	0.055	0.196	1ka6A.pdb.gz	A "three-pronged" binding mechanism for the SAP/SH2D1A SH2 domain: structural basis and relevance to the XLP syndrome.
20	PDB:3qwyA	0.165	0.357	8.247E-6	170	0.089	0.200	3qwyA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z4Y3	0.0	546	377	0.697	0.703	A0A0S2Z4Y3_HUMAN NCK adaptor protein 1 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=NCK1 PE=2 SV=1
2	B2RZ33	0.0	548	377	0.703	0.708	B2RZ33_RAT Cytoplasmic protein OS=Rattus norvegicus OX=10116 GN=Nck1 PE=1 SV=1
3	D4A3M8	0.0	748	380	0.958	0.958	D4A3M8_RAT Cytoplasmic protein OS=Rattus norvegicus OX=10116 GN=Nck2 PE=1 SV=1
4	O43639	0.0	790	380	1.000	1.000	NCK2_HUMAN Cytoplasmic protein NCK2 OS=Homo sapiens OX=9606 GN=NCK2 PE=1 SV=2
5	O55033	0.0	750	380	0.961	0.961	NCK2_MOUSE Cytoplasmic protein NCK2 OS=Mus musculus OX=10090 GN=Nck2 PE=1 SV=1
6	P16333	0.0	546	377	0.697	0.703	NCK1_HUMAN Cytoplasmic protein NCK1 OS=Homo sapiens OX=9606 GN=NCK1 PE=1 SV=1
7	Q99M51	0.0	547	377	0.700	0.706	NCK1_MOUSE Cytoplasmic protein NCK1 OS=Mus musculus OX=10090 GN=Nck1 PE=1 SV=1
8	Q8IPW2	2.61e-107	323	410	0.455	0.422	Q8IPW2_DROME Dreadlocks, isoform A OS=Drosophila melanogaster OX=7227 GN=dock PE=1 SV=1
9	Q24218	3.01e-107	323	410	0.455	0.422	Q24218_DROME SH2/SH3 adaptor protein OS=Drosophila melanogaster OX=7227 GN=dock PE=1 SV=1
10	Q9VPU1	4.80e-106	324	548	0.455	0.316	Q9VPU1_DROME Dreadlocks, isoform B OS=Drosophila melanogaster OX=7227 GN=dock PE=1 SV=1
11	Q95PX0	2.45e-91	281	397	0.453	0.433	Q95PX0_CAEEL NCK (Non-Catalytic region of tyrosine Kinase) adaptor protein family OS=Caenorhabditis elegans OX=6239 GN=nck-1 PE=1 SV=2
12	Q95PW9	4.87e-91	281	395	0.455	0.438	Q95PW9_CAEEL NCK (Non-Catalytic region of tyrosine Kinase) adaptor protein family OS=Caenorhabditis elegans OX=6239 GN=nck-1 PE=1 SV=2
13	A0A0S2Z4E4	6.91e-64	206	244	0.334	0.520	A0A0S2Z4E4_HUMAN NCK adaptor protein 1 isoform 3 (Fragment) OS=Homo sapiens OX=9606 GN=NCK1 PE=1 SV=1
14	C9J869	1.27e-60	194	162	0.247	0.580	C9J869_HUMAN NCK adaptor protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=NCK1 PE=1 SV=1
15	A0A0S2Z4D7	3.03e-60	194	170	0.247	0.553	A0A0S2Z4D7_HUMAN NCK adaptor protein 1 isoform 2 OS=Homo sapiens OX=9606 GN=NCK1 PE=1 SV=1
16	C9JVV5	5.89e-59	189	129	0.242	0.713	C9JVV5_HUMAN NCK adaptor protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=NCK1 PE=1 SV=1
17	H7C5C7	2.12e-51	170	141	0.226	0.610	H7C5C7_HUMAN NCK adaptor protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=NCK1 PE=1 SV=1
18	E7ERP6	1.24e-46	155	83	0.197	0.904	E7ERP6_HUMAN NCK adaptor protein 2 OS=Homo sapiens OX=9606 GN=NCK2 PE=1 SV=1
19	Q13588	1.15e-19	88.6	217	0.147	0.258	GRAP_HUMAN GRB2-related adapter protein OS=Homo sapiens OX=9606 GN=GRAP PE=1 SV=1
20	F8W7U0	5.30e-18	88.2	1149	0.182	0.060	F8W7U0_HUMAN Intersectin 1 OS=Homo sapiens OX=9606 GN=ITSN1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17299 DUF5350	6.8e+02	12.2	Family of unknown function (DUF5350)
2	PF14603 hSH3	1	21.2	Helically-extended SH3 domain
3	PF00017 SH2	4e-18	76.6	SH2 domain
4	PF14633 SH2_2	31	15.4	SH2 domain
5	PF00018 SH3_1	7.5e-39	142.4	SH3 domain
6	PF17902 SH3_10	0.00069	30.9	SH3 domain
7	PF07653 SH3_2	5.2e-23	91.9	Variant SH3 domain
8	PF08239 SH3_3	8.6e-05	34.2	Bacterial SH3 domain
9	PF14604 SH3_9	2.1e-36	134.9	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000014405

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000003101	0.988	P21 protein (Cdc42/Rac)-activated kinase 1
2	9593.ENSGGOP00000009730	0.987	ephrin-B1
3	9593.ENSGGOP00000026330	0.987	ephrin-B2
4	9593.ENSGGOP00000007089	0.981	P21 protein (Cdc42/Rac)-activated kinase 2
5	9593.ENSGGOP00000020999	0.976	LIM zinc finger domain containing 1
6	9593.ENSGGOP00000021545	0.976	LIM zinc finger domain containing 1
7	9593.ENSGGOP00000012526	0.975	Kinase insert domain receptor (a type III receptor tyrosine kinase)
8	9593.ENSGGOP00000025725	0.972	NCK adaptor protein 1
9	9593.ENSGGOP00000021603	0.971	Lymphocyte cytosolic protein 2 (SH2 domain containing leukocyte protein of 76kDa)
10	9593.ENSGGOP00000005010	0.942	P21 protein (Cdc42/Rac)-activated kinase 7
11	9593.ENSGGOP00000007465	0.928	Receptor protein-tyrosine kinase
12	9593.ENSGGOP00000012207	0.928	Uncharacterized protein
13	9593.ENSGGOP00000010349	0.925	Ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2)
14	9593.ENSGGOP00000017210	0.925	Wiskott-Aldrich syndrome-like
15	9593.ENSGGOP00000020321	0.924	Belongs to the protein kinase superfamily. Tyr protein kinase family. CSF-1/PDGF receptor subfamily.
16	9593.ENSGGOP00000001433	0.911	Roundabout, axon guidance receptor, homolog 1 (Drosophila)
17	9593.ENSGGOP00000000203	0.901	Docking protein 2, 56kDa
18	9593.ENSGGOP00000000385	0.890	Integrin-linked kinase
19	9593.ENSGGOP00000017133	0.888	DAB1, reelin adaptor protein
20	9593.ENSGGOP00000014411	0.877	P21 protein (Cdc42/Rac)-activated kinase 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.870	enzyme binding
GO:0005102	0.838	signaling receptor binding
GO:0019900	0.787	kinase binding
GO:0044877	0.634	protein-containing complex binding
GO:0019901	0.510	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0051716	0.982	cellular response to stimulus
GO:0048522	0.982	positive regulation of cellular process
GO:0048583	0.977	regulation of response to stimulus
GO:0060255	0.970	regulation of macromolecule metabolic process
GO:0031323	0.970	regulation of cellular metabolic process
GO:0080090	0.967	regulation of primary metabolic process
GO:0051246	0.963	regulation of protein metabolic process
GO:0009966	0.963	regulation of signal transduction
GO:0048523	0.961	negative regulation of cellular process
GO:0007165	0.958	signal transduction
GO:0009893	0.944	positive regulation of metabolic process
GO:0042325	0.942	regulation of phosphorylation
GO:0010604	0.933	positive regulation of macromolecule metabolic process
GO:0001932	0.928	regulation of protein phosphorylation
GO:0016043	0.923	cellular component organization
GO:0031325	0.923	positive regulation of cellular metabolic process
GO:0032501	0.917	multicellular organismal process
GO:0051173	0.914	positive regulation of nitrogen compound metabolic process
GO:0007169	0.912	transmembrane receptor protein tyrosine kinase signaling pathway
GO:1902903	0.909	regulation of supramolecular fiber organization
GO:0032956	0.899	regulation of actin cytoskeleton organization
GO:0043254	0.896	regulation of protein-containing complex assembly
GO:0048856	0.892	anatomical structure development
GO:0032271	0.892	regulation of protein polymerization
GO:0045936	0.883	negative regulation of phosphate metabolic process
GO:0001933	0.873	negative regulation of protein phosphorylation
GO:0110053	0.870	regulation of actin filament organization
GO:0007275	0.861	multicellular organism development
GO:0031334	0.854	positive regulation of protein-containing complex assembly
GO:2001233	0.844	regulation of apoptotic signaling pathway
GO:0032273	0.838	positive regulation of protein polymerization
GO:0008064	0.820	regulation of actin polymerization or depolymerization
GO:0048584	0.811	positive regulation of response to stimulus
GO:0030833	0.811	regulation of actin filament polymerization
GO:0080135	0.807	regulation of cellular response to stress
GO:1902531	0.800	regulation of intracellular signal transduction
GO:1900101	0.782	regulation of endoplasmic reticulum unfolded protein response
GO:1905898	0.772	positive regulation of response to endoplasmic reticulum stress
GO:0120036	0.768	plasma membrane bounded cell projection organization
GO:0048731	0.762	system development
GO:0006950	0.739	response to stress
GO:0048869	0.729	cellular developmental process
GO:0043620	0.729	regulation of DNA-templated transcription in response to stress
GO:0030154	0.724	cell differentiation
GO:0097581	0.696	lamellipodium organization
GO:0007399	0.654	nervous system development
GO:1902533	0.652	positive regulation of intracellular signal transduction
GO:2000112	0.629	regulation of cellular macromolecule biosynthetic process
GO:0034248	0.628	regulation of amide metabolic process
GO:0051495	0.619	positive regulation of cytoskeleton organization
GO:0051239	0.587	regulation of multicellular organismal process
GO:0022008	0.574	neurogenesis
GO:0010608	0.561	post-transcriptional regulation of gene expression
GO:0030155	0.549	regulation of cell adhesion
GO:0006417	0.549	regulation of translation
GO:0030838	0.548	positive regulation of actin filament polymerization
GO:0048699	0.544	generation of neurons
GO:0008152	0.530	metabolic process
GO:0044237	0.518	cellular metabolic process
GO:1903573	0.515	negative regulation of response to endoplasmic reticulum stress
GO:0043618	0.514	regulation of transcription from RNA polymerase II promoter in response to stress
GO:0048468	0.476	cell development
GO:0071704	0.473	organic substance metabolic process
GO:0044238	0.460	primary metabolic process
GO:0044085	0.453	cellular component biogenesis
GO:0051247	0.443	positive regulation of protein metabolic process
GO:0006807	0.421	nitrogen compound metabolic process
GO:0006996	0.415	organelle organization
GO:0006446	0.399	regulation of translational initiation
GO:0002682	0.363	regulation of immune system process
GO:0048870	0.360	cell motility
GO:1901564	0.330	organonitrogen compound metabolic process
GO:0031175	0.325	neuron projection development
GO:0065009	0.310	regulation of molecular function

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043227	0.999	membrane-bounded organelle
GO:0043229	0.998	intracellular organelle
GO:0016020	0.993	membrane
GO:0012505	0.988	endomembrane system
GO:0043231	0.986	intracellular membrane-bounded organelle
GO:0005886	0.940	plasma membrane
GO:0031982	0.912	vesicle
GO:0030054	0.857	cell junction
GO:0031090	0.425	organelle membrane
GO:0070161	0.389	anchoring junction
GO:0032991	0.365	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]