StarFunc result for job id O43657

User Input

>input (245 residues)
MASPSRRLQTKPVITCFKSVLLIYTFIFWITGVILLAVGIWGKVSLENYFSLLNEKATNV
PFVLIATGTVIILLGTFGCFATCRASAWMLKLYAMFLTLVFLVELVAAIVGFVFRHEIKN
SFKNNYEKALKQYNSTGDYRSHAVDKIQNTLHCCGVTDYRDWTDTNYYSEKGFPKSCCKL
EDCTPQRDADKVNNEGCFIKVMTIIESEMGVVAGISFGVACFQLIGIFLAYCLSRAITNN
QYEIV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43657	1.000	1.000	6.987E-35	245	1.000	1.000	O43657.pdb.gz	TSN6_HUMAN Tetraspanin-6 OS=Homo sapiens OX=9606 GN=TSPAN6 PE=1 SV=1
2	AFDB:B0BNE7	0.891	0.877	9.638E-24	249	0.588	0.578	B0BNE7.pdb.gz	B0BNE7_RAT Tetraspanin OS=Rattus norvegicus OX=10116 GN=Tspan7 PE=3 SV=1
3	AFDB:O60637	0.870	0.844	1.414E-14	253	0.310	0.300	O60637.pdb.gz	TSN3_HUMAN Tetraspanin-3 OS=Homo sapiens OX=9606 GN=TSPAN3 PE=2 SV=1
4	AFDB:A0A024RB05	0.860	0.883	1.990E-14	238	0.286	0.294	A0A024RB05.pdb.gz
5	AFDB:O35566	0.780	0.758	3.406E-14	253	0.294	0.285	O35566.pdb.gz	CD151_MOUSE CD151 antigen OS=Mus musculus OX=10090 GN=Cd151 PE=1 SV=2
6	AFDB:P28648	0.863	0.886	5.036E-14	238	0.265	0.273	P28648.pdb.gz	CD63_RAT CD63 antigen OS=Rattus norvegicus OX=10116 GN=Cd63 PE=1 SV=2
7	AFDB:Q6NWG0	0.781	0.786	7.444E-14	243	0.261	0.263	Q6NWG0.pdb.gz	TSN36_DANRE Tetraspanin-36 OS=Danio rerio OX=7955 GN=tspan36 PE=1 SV=2
8	AFDB:O75954	0.790	0.808	5.518E-13	239	0.245	0.251	O75954.pdb.gz	TSN9_HUMAN Tetraspanin-9 OS=Homo sapiens OX=9606 GN=TSPAN9 PE=1 SV=1
9	AFDB:P27701	0.743	0.689	1.330E-12	267	0.269	0.247	P27701.pdb.gz	CD82_HUMAN CD82 antigen OS=Homo sapiens OX=9606 GN=CD82 PE=1 SV=1
10	AFDB:Q86UF1	0.746	0.656	1.330E-12	283	0.261	0.226	Q86UF1.pdb.gz	TSN33_HUMAN Tetraspanin-33 OS=Homo sapiens OX=9606 GN=TSPAN33 PE=1 SV=1
11	PDB:6k4jA	0.577	0.635	3.501E-9	220	0.216	0.241	6k4jA.pdb.gz
12	PDB:6wvgA	0.668	0.385	6.292E-9	443	0.229	0.126	6wvgA.pdb.gz
13	PDB:7zw1A	0.529	0.434	4.635E-7	317	0.180	0.139	7zw1A.pdb.gz
14	PDB:5tcxA	0.532	0.606	1.734E-6	208	0.204	0.240	5tcxA.pdb.gz	Crystal Structure of a Full-Length Human Tetraspanin Reveals a Cholesterol-Binding Pocket.
15	PDB:7zw1B	0.413	0.341	5.565E-5	316	0.184	0.142	7zw1B.pdb.gz
16	PDB:6aygA	0.240	0.145	9.288E-1	439	0.131	0.073	6aygA.pdb.gz
17	PDB:7td1R	0.227	0.197	1.442	293	0.110	0.092	7td1R.pdb.gz	Differential activation mechanisms of lipid GPCRs by lysophosphatidic acid and sphingosine 1-phosphate.
18	PDB:7w9lA	0.180	0.046	1.753	1420	0.131	0.023	7w9lA.pdb.gz	High-resolution structures of human Na v 1.7 reveal gating modulation through alpha-pi helical transition of S6 IV.
19	PDB:5w3sA	0.208	0.120	1.933	485	0.127	0.064	5w3sA.pdb.gz	Cryo-electron microscopy structure of the lysosomal calcium-permeable channel TRPML3.
20	PDB:6wvdA	0.394	0.263	2.131	397	0.086	0.053	6wvdA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43657	0.0	507	245	1.000	1.000	TSN6_HUMAN Tetraspanin-6 OS=Homo sapiens OX=9606 GN=TSPAN6 PE=1 SV=1
2	P41732	1.60e-105	307	249	0.596	0.586	TSN7_HUMAN Tetraspanin-7 OS=Homo sapiens OX=9606 GN=TSPAN7 PE=1 SV=2
3	B0BNE7	6.96e-104	303	249	0.588	0.578	B0BNE7_RAT Tetraspanin OS=Rattus norvegicus OX=10116 GN=Tspan7 PE=3 SV=1
4	F1M8Y2	2.74e-87	259	221	0.527	0.584	F1M8Y2_RAT Tetraspanin OS=Rattus norvegicus OX=10116 GN=Tspan7 PE=3 SV=4
5	P08962	1.37e-33	123	238	0.278	0.286	CD63_HUMAN CD63 antigen OS=Homo sapiens OX=9606 GN=CD63 PE=1 SV=2
6	P28648	7.41e-32	119	238	0.265	0.273	CD63_RAT CD63 antigen OS=Rattus norvegicus OX=10116 GN=Cd63 PE=1 SV=2
7	Q6NWG0	5.47e-31	116	243	0.265	0.267	TSN36_DANRE Tetraspanin-36 OS=Danio rerio OX=7955 GN=tspan36 PE=1 SV=2
8	P41731	2.95e-30	114	238	0.257	0.265	CD63_MOUSE CD63 antigen OS=Mus musculus OX=10090 GN=Cd63 PE=1 SV=2
9	P48509	8.58e-30	114	253	0.302	0.292	CD151_HUMAN CD151 antigen OS=Homo sapiens OX=9606 GN=CD151 PE=1 SV=3
10	Q6P2T9	1.30e-29	112	237	0.302	0.312	Q6P2T9_DANRE Tetraspanin OS=Danio rerio OX=7955 GN=cd163 PE=1 SV=1
11	F8W022	2.16e-29	111	215	0.245	0.279	F8W022_HUMAN Tetraspanin (Fragment) OS=Homo sapiens OX=9606 GN=CD63 PE=1 SV=1
12	F8VWK8	2.45e-29	111	217	0.245	0.276	F8VWK8_HUMAN Tetraspanin (Fragment) OS=Homo sapiens OX=9606 GN=CD63 PE=1 SV=1
13	O60637	1.78e-27	107	253	0.314	0.304	TSN3_HUMAN Tetraspanin-3 OS=Homo sapiens OX=9606 GN=TSPAN3 PE=2 SV=1
14	Q9D7W4	5.36e-26	104	270	0.298	0.270	TSN17_MOUSE Tetraspanin-17 OS=Mus musculus OX=10090 GN=Tspan17 PE=1 SV=1
15	Q96FV3	9.32e-26	103	270	0.294	0.267	TSN17_HUMAN Tetraspanin-17 OS=Homo sapiens OX=9606 GN=TSPAN17 PE=2 SV=2
16	P62079	1.43e-25	103	268	0.282	0.257	TSN5_HUMAN Tetraspanin-5 OS=Homo sapiens OX=9606 GN=TSPAN5 PE=1 SV=1
17	P62080	1.43e-25	103	268	0.282	0.257	TSN5_MOUSE Tetraspanin-5 OS=Mus musculus OX=10090 GN=Tspan5 PE=1 SV=1
18	Q68VK5	1.43e-25	103	268	0.282	0.257	TSN5_RAT Tetraspanin-5 OS=Rattus norvegicus OX=10116 GN=Tspan5 PE=2 SV=2
19	Q9QZA6	4.59e-25	101	253	0.298	0.289	CD151_RAT CD151 antigen OS=Rattus norvegicus OX=10116 GN=Cd151 PE=1 SV=2
20	O35566	6.76e-25	100	253	0.302	0.292	CD151_MOUSE CD151 antigen OS=Mus musculus OX=10090 GN=Cd151 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12729 4HB_MCP_1	3.9	18.5	Four helix bundle sensory module for signal transduction
2	PF07332 Phage_holin_3_6	2.8e+02	13.0	Putative Actinobacterial Holin-X, holin superfamily III
3	PF00335 Tetraspanin	4e-49	178.9	Tetraspanin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000009762

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000027789	0.750	Zinc finger homeobox 4
2	9593.ENSGGOP00000013862	0.746	Uncharacterized protein
3	9593.ENSGGOP00000006024	0.676	Paraneoplastic Ma antigen 1
4	9593.ENSGGOP00000028385	0.672	Mitochondrial antiviral signaling protein
5	9593.ENSGGOP00000023323	0.665	TIMP metallopeptidase inhibitor 1
6	9593.ENSGGOP00000007812	0.664	Polycomb group ring finger 2
7	9593.ENSGGOP00000014843	0.628	N-myc downstream regulated 1
8	9593.ENSGGOP00000021603	0.609	Lymphocyte cytosolic protein 2 (SH2 domain containing leukocyte protein of 76kDa)
9	9593.ENSGGOP00000000945	0.594	Snail family zinc finger 2
10	9593.ENSGGOP00000008500	0.575	FERM and PDZ domain containing 4
11	9593.ENSGGOP00000020132	0.572	Nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2
12	9593.ENSGGOP00000016465	0.570	Chemokine (C-C motif) receptor 1
13	9593.ENSGGOP00000001262	0.541	Adipocyte plasma membrane associated protein
14	9593.ENSGGOP00000018498	0.540	Reticulon 4
15	9593.ENSGGOP00000021910	0.537	Lymphoid enhancer-binding factor 1
16	9593.ENSGGOP00000017855	0.536	Fc fragment of IgE, high affinity I, receptor for
17	9593.ENSGGOP00000022431	0.535	Vesicle-associated membrane protein 3
18	9593.ENSGGOP00000028304	0.529	Claudin
19	9593.ENSGGOP00000009943	0.528	Sirtuin 1
20	9593.ENSGGOP00000010107	0.527	Tumor susceptibility 101

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.563	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0050794	0.988	regulation of cellular process
GO:0048518	0.927	positive regulation of biological process
GO:0048522	0.912	positive regulation of cellular process
GO:0048519	0.910	negative regulation of biological process
GO:0048583	0.873	regulation of response to stimulus
GO:0050776	0.849	regulation of immune response
GO:0032101	0.801	regulation of response to external stimulus
GO:0048584	0.773	positive regulation of response to stimulus
GO:0080134	0.751	regulation of response to stress
GO:1902531	0.728	regulation of intracellular signal transduction
GO:0048585	0.714	negative regulation of response to stimulus
GO:0045088	0.690	regulation of innate immune response
GO:0050688	0.663	regulation of defense response to virus
GO:0048523	0.660	negative regulation of cellular process
GO:0009987	0.609	cellular process
GO:0043122	0.604	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0062207	0.545	regulation of pattern recognition receptor signaling pathway
GO:0023056	0.530	positive regulation of signaling
GO:0023057	0.517	negative regulation of signaling
GO:0032102	0.485	negative regulation of response to external stimulus
GO:0002832	0.453	negative regulation of response to biotic stimulus
GO:1901222	0.424	regulation of NIK/NF-kappaB signaling
GO:0039531	0.421	regulation of viral-induced cytoplasmic pattern recognition receptor signaling pathway
GO:0010647	0.402	positive regulation of cell communication
GO:0050687	0.390	negative regulation of defense response to virus
GO:0010648	0.368	negative regulation of cell communication
GO:0009967	0.311	positive regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.999	membrane-bounded organelle
GO:0005576	0.978	extracellular region
GO:0016020	0.957	membrane
GO:0031982	0.949	vesicle
GO:0071944	0.924	cell periphery
GO:0043230	0.905	extracellular organelle
GO:1903561	0.904	extracellular vesicle
GO:0005615	0.902	extracellular space
GO:0070062	0.887	extracellular exosome
GO:0005622	0.833	intracellular anatomical structure
GO:0005886	0.823	plasma membrane
GO:0043231	0.806	intracellular membrane-bounded organelle
GO:0005737	0.696	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]