StarFunc result for job id O43663

User Input

>input (620 residues)
MRRSEVLAEESIVCLQKALNHLREIWELIGIPEDQRLQRTEVVKKHIKELLDMMIAEEES
LKERLIKSISVCQKELNTLCSELHVEPFQEEGETTILQLEKDLRTQVELMRKQKKERKQE
LKLLQEQDQELCEILCMPHYDIDSASVPSLEELNQFRQHVTTLRETKASRREEFVSIKRQ
IILCMEALDHTPDTSFERDVVCEDEDAFCLSLENIATLQKLLRQLEMQKSQNEAVCEGLR
TQIRELWDRLQIPEEEREAVATIMSGSKAKVRKALQLEVDRLEELKMQNMKKVIEAIRVE
LVQYWDQCFYSQEQRQAFAPFCAEDYTESLLQLHDAEIVRLKNYYEVHKELFEGVQKWEE
TWRLFLEFERKASDPNRFTNRGGNLLKEEKQRAKLQKMLPKLEEELKARIELWEQEHSKA
FMVNGQKFMEYVAEQWEMHRLEKERAKQERQLKNKKQTETEMLYGSAPRTPSKRRGLAPN
TPGKARKLNTTTMSNATANSSIRPIFGGTVYHSPVSRLPPSGSKPVAASTCSGKKTPRTG
RHGANKENLELNGSILSGGYPGSAPLQRNFSINSVASTYSEFAKDPSLSDSSTVGLQREL
SKASKSDATSGILNSTNIQS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43663	1.000	1.000	1.326E-74	620	1.000	1.000	O43663.pdb.gz	PRC1_HUMAN Protein regulator of cytokinesis 1 OS=Homo sapiens OX=9606 GN=PRC1 PE=1 SV=2
2	AFDB:Q9FLP0	0.466	0.487	2.235E-17	587	0.211	0.223	Q9FLP0.pdb.gz	MA651_ARATH 65-kDa microtubule-associated protein 1 OS=Arabidopsis thaliana OX=3702 GN=MAP65-1 PE=1 SV=1
3	AFDB:Q8LEG3	0.443	0.470	5.997E-16	578	0.192	0.206	Q8LEG3.pdb.gz	MA652_ARATH 65-kDa microtubule-associated protein 2 OS=Arabidopsis thaliana OX=3702 GN=MAP65-2 PE=1 SV=1
4	AFDB:Q9P6S3	0.101	0.065	3.126E-3	1052	0.174	0.103	Q9P6S3.pdb.gz	UDS1_SCHPO Up-regulated during septation protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=uds1 PE=1 SV=1
5	AFDB:E9Q8Q6	0.128	0.067	3.762E-3	1531	0.161	0.065	E9Q8Q6.pdb.gz	CC141_MOUSE Coiled-coil domain-containing protein 141 OS=Mus musculus OX=10090 GN=Ccdc141 PE=1 SV=2
6	AFDB:Q14152	0.076	0.043	6.561E-3	1382	0.173	0.077	Q14152.pdb.gz	EIF3A_HUMAN Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens OX=9606 GN=EIF3A PE=1 SV=1
7	AFDB:F4HRT5	0.073	0.043	1.092E-2	1132	0.174	0.095	F4HRT5.pdb.gz	CRWN1_ARATH Protein CROWDED NUCLEI 1 OS=Arabidopsis thaliana OX=3702 GN=CRWN1 PE=1 SV=1
8	AFDB:Q05050	0.101	0.077	1.092E-2	843	0.137	0.101	Q05050.pdb.gz	EIS1_YEAST Eisosome protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EIS1 PE=1 SV=1
9	AFDB:A5PK42	0.113	0.105	1.442E-2	683	0.139	0.126	A5PK42.pdb.gz	ODAD4_BOVIN Outer dynein arm-docking complex subunit 4 OS=Bos taurus OX=9913 GN=ODAD4 PE=1 SV=1
10	AFDB:Q6NRG6	0.079	0.073	1.511E-2	668	0.168	0.156	Q6NRG6.pdb.gz	SAS6_XENLA Spindle assembly abnormal protein 6 homolog OS=Xenopus laevis OX=8355 GN=sas6 PE=2 SV=1
11	PDB:7abgA4	0.089	0.122	4.529E-1	405	0.061	0.094	7abgA4.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
12	PDB:5mkkA	0.075	0.078	1.736	593	0.056	0.059	5mkkA.pdb.gz
13	PDB:7d6dA	0.113	0.175	1.818	380	0.056	0.092	7d6dA.pdb.gz
14	PDB:7as4L	0.101	0.094	3.321	679	0.108	0.099	7as4L.pdb.gz	Assembly of the asymmetric human gamma-tubulin ring complex by RUVBL1-RUVBL2 AAA ATPase.
15	PDB:7rroA1	0.098	0.144	3.321	396	0.110	0.172	7rroA1.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
16	PDB:4k1nA	0.095	0.110	3.643	520	0.097	0.115	4k1nA.pdb.gz
17	PDB:2zy4F	0.078	0.086	4.187	535	0.037	0.043	2zy4F.pdb.gz	Structure, Assembly, and Mechanism of a PLP-Dependent Dodecameric l-Aspartate beta-Decarboxylase
18	PDB:3hajA	0.063	0.132	4.187	286	0.055	0.119	3hajA.pdb.gz	Molecular mechanism of membrane constriction and tubulation mediated by the F-BAR protein Pacsin/Syndapin.
19	PDB:7rroB1	0.099	0.140	4.187	416	0.095	0.142	7rroB1.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
20	PDB:3c98B	0.082	0.186	5.278	230	0.065	0.174	3c98B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43663	0.0	1274	620	1.000	1.000	PRC1_HUMAN Protein regulator of cytokinesis 1 OS=Homo sapiens OX=9606 GN=PRC1 PE=1 SV=2
2	H0YL53	1.12e-132	388	195	0.313	0.995	H0YL53_HUMAN Protein regulator of cytokinesis 1 (Fragment) OS=Homo sapiens OX=9606 GN=PRC1 PE=1 SV=1
3	Q9VZ62	5.02e-41	160	671	0.263	0.243	Q9VZ62_DROME Fascetto OS=Drosophila melanogaster OX=7227 GN=feo PE=1 SV=1
4	Q9HDY1	2.60e-22	103	731	0.156	0.133	ASE1_SCHPO Anaphase spindle elongation protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ase1 PE=1 SV=1
5	Q8LEG3	8.80e-19	92.4	578	0.245	0.263	MA652_ARATH 65-kDa microtubule-associated protein 2 OS=Arabidopsis thaliana OX=3702 GN=MAP65-2 PE=1 SV=1
6	Q9FLP0	5.35e-18	90.1	587	0.182	0.193	MA651_ARATH 65-kDa microtubule-associated protein 1 OS=Arabidopsis thaliana OX=3702 GN=MAP65-1 PE=1 SV=1
7	Q54VM5	1.22e-15	83.2	771	0.166	0.134	Q54VM5_DICDI Protein regulator of cytokinesis 1 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0280249 PE=3 SV=1
8	F4K3E4	1.39e-14	79.3	616	0.184	0.185	F4K3E4_ARATH Microtubule-associated proteins 65-1 OS=Arabidopsis thaliana OX=3702 GN=MAP65-1 PE=1 SV=1
9	Q9SIS3	7.31e-14	77.0	608	0.189	0.192	MA656_ARATH 65-kDa microtubule-associated protein 6 OS=Arabidopsis thaliana OX=3702 GN=MAP65-6 PE=1 SV=1
10	Q9FHM4	4.52e-12	71.6	707	0.210	0.184	MA653_ARATH 65-kDa microtubule-associated protein 3 OS=Arabidopsis thaliana OX=3702 GN=MAP65-3 PE=1 SV=1
11	G5ED58	1.85e-08	59.7	529	0.110	0.129	G5ED58_CAEEL Protein regulator of cytokinesis 1 OS=Caenorhabditis elegans OX=6239 GN=spd-1 PE=1 SV=1
12	Q54PZ3	1.02e-04	47.8	765	0.050	0.041	Q54PZ3_DICDI Uncharacterized protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0284219 PE=3 SV=1
13	P50275	3.63e-04	46.2	885	0.129	0.090	ASE1_YEAST Anaphase spindle elongation protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ASE1 PE=1 SV=1
14	Q9C7G0	0.027	40.0	562	0.100	0.110	MA658_ARATH 65-kDa microtubule-associated protein 8 OS=Arabidopsis thaliana OX=3702 GN=MAP65-8 PE=1 SV=2
15	Q8CDL9	0.25	37.0	855	0.055	0.040	CCD87_MOUSE Coiled-coil domain-containing protein 87 OS=Mus musculus OX=10090 GN=Ccdc87 PE=1 SV=2
16	Q38BD8	7.0	31.6	213	0.039	0.113	Q38BD8_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.2580 PE=4 SV=1
17	Q57WL0	7.0	32.3	856	0.060	0.043	Q57WL0_TRYB2 Coiled-coil domain-containing protein 39 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.28A12.220 PE=4 SV=1
18	Q9ZVH7	7.8	31.6	335	0.037	0.069	FAX3_ARATH Protein FATTY ACID EXPORT 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FAX3 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03999 MAP65_ASE1	7.1e-157	534.6	Microtubule associated protein (MAP65/ASE1 family)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000377793

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000300093	0.999	Serine/threonine-protein kinase PLK1
2	9606.ENSP00000363524	0.997	Chromosome-associated kinesin KIF4A
3	9606.ENSP00000378356	0.996	Kinesin-like protein KIF20A
4	9606.ENSP00000260731	0.994	Kinesin-like protein KIF11
5	9606.ENSP00000356319	0.989	Kinesin-like protein KIF14
6	9606.ENSP00000378699	0.989	Cyclin-dependent kinase 1
7	9606.ENSP00000300403	0.988	Targeting protein for Xklp2
8	9606.ENSP00000404190	0.988	Rac GTPase-activating protein 1
9	9606.ENSP00000265148	0.987	Centromere-associated protein E
10	9606.ENSP00000251496	0.986	Condensin complex subunit 3
11	9606.ENSP00000361540	0.985	Cell division cycle protein 20 homolog
12	9606.ENSP00000260363	0.982	Kinesin-like protein KIF23
13	9606.ENSP00000453403	0.982	Nucleolar and spindle-associated protein 1
14	9606.ENSP00000256442	0.980	G2/mitotic-specific cyclin-B1
15	9606.ENSP00000358813	0.980	Dual specificity protein kinase TTK
16	9606.ENSP00000356379	0.976	Abnormal spindle-like microcephaly-associated protein
17	9606.ENSP00000261597	0.971	Kinetochore protein NDC80 homolog
18	9606.ENSP00000313950	0.971	Aurora kinase B
19	9606.ENSP00000216911	0.968	Aurora kinase A
20	9606.ENSP00000288207	0.966	G2/mitotic-specific cyclin-B2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0019894	1.000	kinesin binding
GO:0019901	1.000	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:1903047	0.990	mitotic cell cycle process
GO:0051726	0.989	regulation of cell cycle
GO:0010564	0.983	regulation of cell cycle process
GO:0000070	0.976	mitotic sister chromatid segregation
GO:0048518	0.975	positive regulation of biological process
GO:0007052	0.968	mitotic spindle organization
GO:0048522	0.966	positive regulation of cellular process
GO:0051302	0.947	regulation of cell division
GO:0051231	0.924	spindle elongation
GO:0042127	0.879	regulation of cell population proliferation
GO:0032465	0.861	regulation of cytokinesis
GO:0000022	0.850	mitotic spindle elongation
GO:0008284	0.787	positive regulation of cell population proliferation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005829	0.999	cytosol
GO:0005819	0.999	spindle
GO:0099080	0.997	supramolecular complex
GO:0005886	0.996	plasma membrane
GO:0045171	0.992	intercellular bridge
GO:0005874	0.992	microtubule
GO:0030496	0.991	midbody
GO:0005876	0.922	spindle microtubule
GO:0070938	0.918	contractile ring
GO:0032991	0.775	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]