StarFunc result for job id O43665

User Input

>input (181 residues)
MFNRAVSRLSRKRPPSDIHDSDGSSSSSHQSLKSTAKWAASLENLLEDPEGVKRFREFLK
KEFSEENVLFWLACEDFKKMQDKTQMQEKAKEIYMTFLSSKASSQVNVEGQSRLNEKILE
EPHPLMFQKLQDQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRASRIYN
T

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43665	1.000	1.000	2.198E-25	181	1.000	1.000	O43665.pdb.gz	RGS10_HUMAN Regulator of G-protein signaling 10 OS=Homo sapiens OX=9606 GN=RGS10 PE=1 SV=3
2	AFDB:O43566	0.715	0.233	1.376E-11	566	0.425	0.136	O43566.pdb.gz	RGS14_HUMAN Regulator of G-protein signaling 14 OS=Homo sapiens OX=9606 GN=RGS14 PE=1 SV=4
3	AFDB:P97492	0.721	0.247	1.968E-11	547	0.414	0.137	P97492.pdb.gz	RGS14_MOUSE Regulator of G-protein signaling 14 OS=Mus musculus OX=10090 GN=Rgs14 PE=1 SV=2
4	AFDB:O08774	0.742	0.102	2.071E-11	1387	0.409	0.053	O08774.pdb.gz	RGS12_RAT Regulator of G-protein signaling 12 OS=Rattus norvegicus OX=10116 GN=Rgs12 PE=1 SV=1
5	AFDB:Q08BE2	0.657	0.574	2.071E-11	208	0.320	0.279	Q08BE2.pdb.gz	Q08BE2_DANRE Regulator of G-protein signaling 18 OS=Danio rerio OX=7955 GN=zgc:153888 PE=2 SV=1
6	AFDB:O14924	0.740	0.099	2.180E-11	1447	0.403	0.050	O14924.pdb.gz	RGS12_HUMAN Regulator of G-protein signaling 12 OS=Homo sapiens OX=9606 GN=RGS12 PE=1 SV=1
7	AFDB:G5EFV0	0.655	0.655	3.633E-11	181	0.293	0.293	G5EFV0.pdb.gz	G5EFV0_CAEEL RGS domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=rgs-2 PE=4 SV=1
8	AFDB:Q6DC84	0.643	0.672	4.456E-11	173	0.315	0.329	Q6DC84.pdb.gz	Q6DC84_DANRE Regulator of G protein-signaling 3a OS=Danio rerio OX=7955 GN=zgc:100933 PE=2 SV=1
9	AFDB:F1QAG9	0.705	0.251	4.689E-11	532	0.370	0.126	F1QAG9.pdb.gz
10	AFDB:A8WGN3	0.634	0.537	1.062E-10	215	0.282	0.237	A8WGN3.pdb.gz
11	PDB:1agrE	0.648	0.903	3.066E-9	128	0.298	0.422	1agrE.pdb.gz	Structure of RGS4 bound to AlF4--activated G(i alpha1): stabilization of the transition state for GTP hydrolysis.
12	PDB:7shfC	0.607	0.285	4.130E-7	400	0.238	0.107	7shfC.pdb.gz	Cryo-EM structure of human GPR158 receptor coupled to the RGS7-G beta 5 signaling complex.
13	PDB:3c4wB	0.470	0.180	8.772E-4	519	0.160	0.056	3c4wB.pdb.gz	Structures of rhodopsin kinase in different ligand states reveal key elements involved in G protein-coupled receptor kinase activation.
14	PDB:6pjxA	0.489	0.176	1.132E-3	543	0.133	0.044	6pjxA.pdb.gz	Structure of a GRK5-Calmodulin Complex Reveals Molecular Mechanism of GRK Activation and Substrate Targeting.
15	PDB:4mk0A	0.516	0.169	2.988E-3	631	0.138	0.040	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
16	PDB:3c51B	0.441	0.191	1.071E-2	461	0.138	0.054	3c51B.pdb.gz	Structures of rhodopsin kinase in different ligand states reveal key elements involved in G protein-coupled receptor kinase activation.
17	PDB:3pvuA	0.498	0.169	1.128E-2	609	0.127	0.038	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
18	PDB:4gouA	0.509	0.193	1.128E-2	507	0.155	0.055	4gouA.pdb.gz
19	PDB:3uzsA	0.502	0.167	2.305E-2	609	0.133	0.039	3uzsA.pdb.gz	Molecular mechanism for inhibition of g protein-coupled receptor kinase 2 by a selective RNA aptamer.
20	PDB:3nynA	0.497	0.174	3.296E-2	554	0.133	0.043	3nynA.pdb.gz	Molecular basis for activation of G protein-coupled receptor kinases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43665	4.73e-133	371	181	1.000	1.000	RGS10_HUMAN Regulator of G-protein signaling 10 OS=Homo sapiens OX=9606 GN=RGS10 PE=1 SV=3
2	Q9CQE5	1.50e-117	332	181	0.923	0.923	RGS10_MOUSE Regulator of G-protein signaling 10 OS=Mus musculus OX=10090 GN=Rgs10 PE=1 SV=1
3	P49806	5.24e-117	330	181	0.934	0.934	RGS10_RAT Regulator of G-protein signaling 10 OS=Rattus norvegicus OX=10116 GN=Rgs10 PE=1 SV=2
4	Q8CGE9	5.30e-42	151	1381	0.398	0.052	RGS12_MOUSE Regulator of G-protein signaling 12 OS=Mus musculus OX=10090 GN=Rgs12 PE=1 SV=2
5	O08774	5.31e-42	151	1387	0.398	0.052	RGS12_RAT Regulator of G-protein signaling 12 OS=Rattus norvegicus OX=10116 GN=Rgs12 PE=1 SV=1
6	O14924	2.23e-41	150	1447	0.392	0.049	RGS12_HUMAN Regulator of G-protein signaling 12 OS=Homo sapiens OX=9606 GN=RGS12 PE=1 SV=1
7	O43566	1.36e-37	137	566	0.409	0.131	RGS14_HUMAN Regulator of G-protein signaling 14 OS=Homo sapiens OX=9606 GN=RGS14 PE=1 SV=4
8	O08773	1.05e-36	135	544	0.403	0.134	RGS14_RAT Regulator of G-protein signaling 14 OS=Rattus norvegicus OX=10116 GN=Rgs14 PE=1 SV=1
9	P97492	1.32e-36	134	547	0.403	0.133	RGS14_MOUSE Regulator of G-protein signaling 14 OS=Mus musculus OX=10090 GN=Rgs14 PE=1 SV=2
10	Q9VCX1	6.99e-32	122	1541	0.348	0.041	RGS_DROME Regulator of G-protein signaling loco OS=Drosophila melanogaster OX=7227 GN=loco PE=1 SV=2
11	Q08BE2	4.06e-30	111	208	0.304	0.264	Q08BE2_DANRE Regulator of G-protein signaling 18 OS=Danio rerio OX=7955 GN=zgc:153888 PE=2 SV=1
12	P49799	2.12e-29	109	205	0.293	0.259	RGS4_RAT Regulator of G-protein signaling 4 OS=Rattus norvegicus OX=10116 GN=Rgs4 PE=1 SV=1
13	Q7SXC7	2.40e-29	114	532	0.337	0.115	Q7SXC7_DANRE Regulator of G-protein signaling 14 OS=Danio rerio OX=7955 GN=rgs14 PE=2 SV=1
14	P49798	3.02e-29	108	205	0.293	0.259	RGS4_HUMAN Regulator of G-protein signaling 4 OS=Homo sapiens OX=9606 GN=RGS4 PE=1 SV=1
15	O08899	4.17e-29	108	205	0.287	0.254	RGS4_MOUSE Regulator of G-protein signaling 4 OS=Mus musculus OX=10090 GN=Rgs4 PE=2 SV=1
16	Q08116	9.97e-29	107	209	0.337	0.292	RGS1_HUMAN Regulator of G-protein signaling 1 OS=Homo sapiens OX=9606 GN=RGS1 PE=1 SV=3
17	A0A5S9EHU3	2.51e-28	104	147	0.287	0.354	A0A5S9EHU3_MOUSE Regulator of G protein Signaling 21 variant 2 OS=Mus musculus OX=10090 GN=Rgs21 PE=2 SV=1
18	V9GXQ3	2.76e-28	105	152	0.287	0.342	V9GXQ3_MOUSE Regulator of G protein Signaling 21 variant 1 OS=Mus musculus OX=10090 GN=Rgs21 PE=2 SV=1
19	A0A087WUY2	3.92e-28	105	192	0.337	0.318	A0A087WUY2_HUMAN Regulator of G protein signaling 3 OS=Homo sapiens OX=9606 GN=RGS3 PE=1 SV=1
20	F1M0G0	1.96e-27	104	210	0.276	0.238	F1M0G0_RAT Regulator of G-protein signaling 17 OS=Rattus norvegicus OX=10116 GN=Rgs17 PE=4 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03748 FliL	2.6e+02	13.6	Flagellar basal body-associated protein FliL
2	PF00615 RGS	1.7e-29	113.9	Regulator of G protein signaling domain
3	PF09128 RGS-like	27	16.0	Regulator of G protein signalling-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358099

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358867	0.973	Guanine nucleotide-binding protein G(k) subunit alpha
2	9606.ENSP00000356430	0.918	Regulator of G-protein signaling 18
3	9606.ENSP00000378483	0.918	Regulator of G-protein signaling 19
4	9606.ENSP00000451030	0.915	Regulator of G-protein signaling 6
5	9606.ENSP00000355523	0.914	Regulator of G-protein signaling 7
6	9606.ENSP00000356429	0.914	Regulator of G-protein signaling 1
7	9606.ENSP00000442837	0.914	Regulator of G-protein signaling 13
8	9606.ENSP00000297313	0.912	Regulator of G-protein signaling 20
9	9606.ENSP00000356194	0.912	Regulator of G-protein signaling 17
10	9606.ENSP00000356529	0.912	Regulator of G-protein signaling 16
11	9606.ENSP00000397181	0.912	Regulator of G-protein signaling 4
12	9606.ENSP00000258302	0.911	Regulator of G-protein signaling 8
13	9606.ENSP00000363255	0.911	Regulator of G-protein signaling 3
14	9606.ENSP00000380876	0.910	Regulator of G-protein signaling 11
15	9606.ENSP00000386229	0.909	Regulator of G-protein signaling 14
16	9606.ENSP00000339381	0.908	Regulator of G-protein signaling 12
17	9606.ENSP00000262406	0.907	Regulator of G-protein signaling 9
18	9606.ENSP00000428343	0.901	Regulator of G-protein signaling 21
19	9606.ENSP00000433001	0.901	Regulator of G-protein signaling 5
20	9606.ENSP00000343027	0.812	Guanine nucleotide-binding protein G(i) subunit alpha-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005096	1.000	GTPase activator activity
GO:0016818	0.995	hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
GO:0003924	0.976	GTPase activity
GO:0001965	0.864	G-protein alpha-subunit binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0050896	0.998	response to stimulus
GO:1901698	0.992	response to nitrogen compound
GO:0007165	0.987	signal transduction
GO:0010243	0.983	response to organonitrogen compound
GO:0007186	0.946	G protein-coupled receptor signaling pathway
GO:0065009	0.609	regulation of molecular function
GO:0050790	0.603	regulation of catalytic activity
GO:0051336	0.594	regulation of hydrolase activity
GO:0051345	0.488	positive regulation of hydrolase activity
GO:0048583	0.476	regulation of response to stimulus
GO:0008277	0.473	regulation of G protein-coupled receptor signaling pathway
GO:1905144	0.336	response to acetylcholine
GO:0043087	0.335	regulation of GTPase activity
GO:0043547	0.316	positive regulation of GTPase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005634	0.991	nucleus
GO:0005886	0.986	plasma membrane
GO:0005829	0.951	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.6.1.-	0.995	In phosphorus-containing anhydrides.
RHEA:19669	0.976	GTP + H2O = GDP + H(+) + phosphate

[back to server]