StarFunc result for job id O43670

User Input

>input (478 residues)
MGRKKKKQLKPWCWYCNRDFDDEKILIQHQKAKHFKCHICHKKLYTGPGLAIHCMQVHKE
TIDAVPNAIPGRTDIELEIYGMEGIPEKDMDERRRLLEQKTQESQKKKQQDDSDEYDDDD
SAASTSFQPQPVQPQQGYIPPMAQPGLPPVPGAPGMPPGIPPLMPGVPPLMPGMPPVMPG
MPPGMMPMGGMMPPGPGIPPLMPGMPPGMPPPVPRPGIPPMTQAQAVSAPGILNRPPAPT
ATVPAPQPPVTKPLFPSAGQMGTPVTSSSTASSNSESLSASSKALFPSTAQAQAAVQGPV
GTDFKPLNSTPATTTEPPKPTFPAYTQSTASTTSTTNSTAAKPAASITSKPATLTTTSAT
SKLIHPDEDISLEERRAQLPKYQRNLPRPGQAPIGNPPVGPIGGMMPPQPGIPQQQGMRP
PMPPHGQYGGHHQGMPGYLPGAMPPYGQGPPMVPPYQGGPPRPPMGMRPPVMSQGGRY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:X6R4W8	0.278	0.269	1.624E-59	497	0.971	0.934	X6R4W8.pdb.gz	X6R4W8_HUMAN Zinc finger protein 207 OS=Homo sapiens OX=9606 GN=ZNF207 PE=1 SV=1
2	AFDB:Q7ZXV8	0.259	0.272	5.488E-48	452	0.734	0.777	Q7ZXV8.pdb.gz	ZN207_XENLA BUB3-interacting and GLEBS motif-containing protein ZNF207 OS=Xenopus laevis OX=8355 GN=znf207 PE=1 SV=1
3	AFDB:Q9C5G0	0.185	0.236	2.077E-17	367	0.270	0.351	Q9C5G0.pdb.gz	SUF4_ARATH Protein SUPPRESSOR OF FRI 4 OS=Arabidopsis thaliana OX=3702 GN=SUF4 PE=1 SV=1
4	AFDB:Q8IJV1	0.221	0.290	4.207E-14	362	0.203	0.268	Q8IJV1.pdb.gz	Q8IJV1_PLAF7 Zinc finger protein, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1009400 PE=4 SV=1
5	AFDB:Q5EXX3	0.098	0.047	4.471E-2	1203	0.142	0.057	Q5EXX3.pdb.gz	ZBT38_RAT Zinc finger and BTB domain-containing protein 38 OS=Rattus norvegicus OX=10116 GN=Zbtb38 PE=2 SV=1
6	AFDB:G8BGH3	0.085	0.061	1.405E-1	724	0.184	0.122	G8BGH3.pdb.gz	G8BGH3_CANPC BCR1 OS=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) OX=578454 GN=BCR1 PE=4 SV=1
7	AFDB:Q6FWW9	0.078	0.056	1.720E-1	823	0.132	0.077	Q6FWW9.pdb.gz	Q6FWW9_CANGA Candida glabrata strain CBS138 chromosome C complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=GLN3 PE=4 SV=1
8	AFDB:Q9U6M6	0.073	0.050	3.610E-1	751	0.190	0.121	Q9U6M6.pdb.gz	Q9U6M6_DORPE Clathrin assembly protein AP180 OS=Doryteuthis pealeii OX=1051067 GN=AP180 PE=2 SV=1
9	AFDB:Q8BW22	0.071	0.079	5.785E-1	402	0.132	0.157	Q8BW22.pdb.gz	CREST_MOUSE Calcium-responsive transactivator OS=Mus musculus OX=10090 GN=Ss18l1 PE=1 SV=1
10	PDB:4r8pL	0.051	0.077	6.302E-1	254	0.025	0.047	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
11	AFDB:D4AD99	0.078	0.051	1.214	756	0.167	0.106	D4AD99.pdb.gz	D4AD99_RAT Cytoplasmic polyadenylation element binding protein 3 OS=Rattus norvegicus OX=10116 GN=Cpeb3 PE=1 SV=3
12	PDB:5vvrJ	0.034	0.211	2.775	70	0.008	0.057	5vvrJ.pdb.gz	Structural basis for the initiation of eukaryotic transcription-coupled DNA repair.
13	PDB:5gm6a	0.034	0.100	3.175	123	0.021	0.081	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
14	PDB:7nacm	0.062	0.048	3.396	666	0.050	0.036	7nacm.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
15	PDB:7uhyA	0.045	0.030	3.396	771	0.021	0.013	7uhyA.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
16	PDB:4fjcE	0.035	0.038	3.633	434	0.010	0.012	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
17	PDB:4wa6D	0.035	0.039	4.757	415	0.010	0.012	4wa6D.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
18	PDB:5apnp	0.027	0.103	5.088	91	0.010	0.055	5apnp.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
19	PDB:6gejS	0.051	0.091	5.822	208	0.023	0.053	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
20	PDB:7uhyD	0.035	0.053	5.822	288	0.013	0.021	7uhyD.pdb.gz	Structure of the nutrient-sensing hub GATOR2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	J3QRS9	0.0	920	493	0.992	0.961	J3QRS9_HUMAN Zinc finger protein 207 OS=Homo sapiens OX=9606 GN=ZNF207 PE=1 SV=1
2	O43670	0.0	940	478	1.000	1.000	ZN207_HUMAN BUB3-interacting and GLEBS motif-containing protein ZNF207 OS=Homo sapiens OX=9606 GN=ZNF207 PE=1 SV=1
3	Q7ZXV8	0.0	541	452	0.728	0.770	ZN207_XENLA BUB3-interacting and GLEBS motif-containing protein ZNF207 OS=Xenopus laevis OX=8355 GN=znf207 PE=1 SV=1
4	Q9JMD0	0.0	917	495	0.990	0.956	ZN207_MOUSE BUB3-interacting and GLEBS motif-containing protein ZNF207 OS=Mus musculus OX=10090 GN=Znf207 PE=1 SV=1
5	X6R4W8	0.0	896	497	0.973	0.936	X6R4W8_HUMAN Zinc finger protein 207 OS=Homo sapiens OX=9606 GN=ZNF207 PE=1 SV=1
6	Q9VJI6	3.13e-55	190	357	0.167	0.224	Q9VJI6_DROME Bub3 interacting GLEBS and zinc finger domain protein, isoform A OS=Drosophila melanogaster OX=7227 GN=BuGZ PE=1 SV=2
7	X2JED0	4.31e-54	190	476	0.167	0.168	X2JED0_DROME Bub3 interacting GLEBS and zinc finger domain protein, isoform G OS=Drosophila melanogaster OX=7227 GN=BuGZ PE=1 SV=1
8	A8DZ09	1.87e-53	190	562	0.169	0.144	A8DZ09_DROME Bub3 interacting GLEBS and zinc finger domain protein, isoform B OS=Drosophila melanogaster OX=7227 GN=BuGZ PE=1 SV=1
9	M9PBC6	3.58e-53	191	622	0.169	0.130	M9PBC6_DROME Bub3 interacting GLEBS and zinc finger domain protein, isoform F OS=Drosophila melanogaster OX=7227 GN=BuGZ PE=1 SV=1
10	M9PG25	3.41e-48	176	568	0.165	0.139	M9PG25_DROME Bub3 interacting GLEBS and zinc finger domain protein, isoform E OS=Drosophila melanogaster OX=7227 GN=BuGZ PE=1 SV=1
11	Q9C5G0	5.24e-37	141	367	0.119	0.155	SUF4_ARATH Protein SUPPRESSOR OF FRI 4 OS=Arabidopsis thaliana OX=3702 GN=SUF4 PE=1 SV=1
12	Q8IJV1	4.63e-35	136	362	0.132	0.174	Q8IJV1_PLAF7 Zinc finger protein, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1009400 PE=4 SV=1
13	O14776	2.8	33.1	1098	0.073	0.032	TCRG1_HUMAN Transcription elongation regulator 1 OS=Homo sapiens OX=9606 GN=TCERG1 PE=1 SV=2
14	Q92793	6.7	32.0	2442	0.056	0.011	CBP_HUMAN CREB-binding protein OS=Homo sapiens OX=9606 GN=CREBBP PE=1 SV=3
15	Q9I8L4	8.7	31.6	1281	0.069	0.026	Q9I8L4_DANRE Period circadian protein homolog 3 OS=Danio rerio OX=7955 GN=Per3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06467 zf-FCS	2.9e+02	12.8	MYM-type Zinc finger with FCS sequence motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9544.ENSMMUP00000022184

Rank	PPI partner	STRING score	Description
1	9544.ENSMMUP00000004124	0.918	Mitotic checkpoint protein BUB3 isoform a
2	9544.ENSMMUP00000020111	0.918	Uncharacterized protein
3	9544.ENSMMUP00000024940	0.800	NDC80, kinetochore complex component
4	9544.ENSMMUP00000004848	0.795	Cytoskeleton associated protein 5
5	9544.ENSMMUP00000023228	0.771	BUB1 mitotic checkpoint serine/threonine kinase
6	9544.ENSMMUP00000029453	0.717	Uncharacterized protein
7	9544.ENSMMUP00000027030	0.714	Platelet-activating factor acetylhydrolase IB subunit alpha
8	9544.ENSMMUP00000036136	0.714	Uncharacterized protein
9	9544.ENSMMUP00000013218	0.638	Splicing factor 3a, subunit 2, 66kDa
10	9544.ENSMMUP00000021937	0.635	BUB1 mitotic checkpoint serine/threonine kinase B
11	9544.ENSMMUP00000005976	0.622	Zinc finger matrin-type protein 2
12	9544.ENSMMUP00000022561	0.621	Zinc finger protein 462
13	9544.ENSMMUP00000000312	0.607	39S ribosomal protein L3, mitochondrial
14	9544.ENSMMUP00000026346	0.604	Ankyrin repeat domain 2
15	9544.ENSMMUP00000022766	0.600	Serine/threonine-protein kinase PLK
16	9544.ENSMMUP00000032090	0.600	Uncharacterized protein
17	9544.ENSMMUP00000040143	0.593	Protein YIPF
18	9544.ENSMMUP00000016742	0.586	Zinc finger protein with KRAB and SCAN domains 16
19	9544.ENSMMUP00000000510	0.579	Sperm associated antigen 16
20	9544.ENSMMUP00000027853	0.579	TBC1 domain family, member 31

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008017	1.000	microtubule binding
GO:1901363	0.939	heterocyclic compound binding
GO:0097159	0.939	organic cyclic compound binding
GO:0003676	0.909	nucleic acid binding
GO:0003723	0.799	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0000070	0.992	mitotic sister chromatid segregation
GO:0007051	0.991	spindle organization
GO:0070925	0.982	organelle assembly
GO:1902850	0.981	microtubule cytoskeleton organization involved in mitosis
GO:0007052	0.972	mitotic spindle organization
GO:0051225	0.970	spindle assembly
GO:0050789	0.965	regulation of biological process
GO:0050794	0.964	regulation of cellular process
GO:0051983	0.939	regulation of chromosome segregation
GO:1901987	0.914	regulation of cell cycle phase transition
GO:0007346	0.913	regulation of mitotic cell cycle
GO:0090307	0.910	mitotic spindle assembly
GO:1901990	0.864	regulation of mitotic cell cycle phase transition
GO:1902099	0.841	regulation of metaphase/anaphase transition of cell cycle
GO:0030071	0.775	regulation of mitotic metaphase/anaphase transition
GO:1905818	0.767	regulation of chromosome separation
GO:0010965	0.665	regulation of mitotic sister chromatid separation
GO:0050896	0.481	response to stimulus
GO:0048519	0.469	negative regulation of biological process
GO:0045786	0.398	negative regulation of cell cycle
GO:0010948	0.394	negative regulation of cell cycle process
GO:0051783	0.384	regulation of nuclear division
GO:0033047	0.374	regulation of mitotic sister chromatid segregation
GO:0007088	0.369	regulation of mitotic nuclear division
GO:0000075	0.346	cell cycle checkpoint signaling
GO:0007093	0.343	mitotic cell cycle checkpoint signaling
GO:0071173	0.329	spindle assembly checkpoint signaling
GO:2001251	0.324	negative regulation of chromosome organization
GO:1905819	0.324	negative regulation of chromosome separation
GO:1902100	0.324	negative regulation of metaphase/anaphase transition of cell cycle
GO:0071174	0.324	mitotic spindle checkpoint signaling
GO:0071704	0.310	organic substance metabolic process
GO:0033048	0.308	negative regulation of mitotic sister chromatid segregation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0043232	0.997	intracellular non-membrane-bounded organelle
GO:0070013	0.965	intracellular organelle lumen
GO:0005654	0.954	nucleoplasm
GO:0005730	0.799	nucleolus
GO:0005737	0.341	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]